(data stored in ACNUC7421 zone)

EMBL: CP002355.PE511

CP002355.PE511       Location/Qualifiers
FT   CDS_pept        complement(489501..490424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0512"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="COGs: COG0031 Cysteine synthase; InterProIPR005856:
FT                   IPR005859: IPR001926: IPR010916: IPR 001216; KEGG:
FT                   abu:Abu_2299 cysteine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   SPTR: Cysteine synthase; TIGRFAM: cysteine synthase A;
FT                   cysteine synthase; PFAM: Pyridoxal-phosphate dependent
FT                   enzyme; TIGRFAM: cysteine synthase A; cysteine synthases"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33179"
FT                   /db_xref="GOA:E4U014"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E4U014"
FT                   /protein_id="ADR33179.1"
FT                   /translation="MNIASNITELIGNTPLVRLNAPSDQNGATILGKCEFMNPTSSVKD
FT                   RIGFNMIKTAMEAGLINADTLIVEPTSGNTGIALASICAALGLKLTLTMPESMSIERRN
FT                   LLKALGANLVLTPAALGMKGAIDEADALVASNPNAIVLQQFANPANPAIHRVTTAQEIL
FT                   RDTDGKVDIFVAAVGTGGTLTGTGEALRAVLPNIQIIAVEPKDSPVLSGGKPGPHKIQG
FT                   IGAGFVPNVLNTSLYNEVITVSNEDAIAASKALAKTEGLLVGISAGANVHAAALVAARP
FT                   ENKGKTIVTILCDTAERYLSTPLFES"
     atgaatatcg catccaatat cactgaactc atcggcaaca cccctcttgt acgcctgaat        60
     gccccctctg atcagaacgg ggctacgatt ttaggaaaat gcgaatttat gaacccgacc       120
     agttccgtca aagaccggat cgggtttaat atgatcaaaa cggctatgga agcgggattg       180
     atcaatgccg atacccttat cgttgaaccc accagcggta ataccggcat tgcactggcc       240
     tcaatctgtg ccgcattggg attgaaactc accctcacga tgcccgagtc tatgtcgatt       300
     gaacggcgca atctcctcaa agcgctcggt gccaatcttg tactcactcc ggccgctcta       360
     gggatgaaag gggcaattga tgaagccgat gcactggtcg cctccaaccc taacgccatc       420
     gtattgcagc agtttgccaa tccggccaat ccggccatcc accgtgtaac tactgcgcaa       480
     gaaattctcc gcgatacgga cggtaaagtc gatatttttg tcgccgccgt cgggacgggg       540
     ggaaccctta ccggaaccgg cgaagcattg cgtgcagtac tgccgaatat ccaaatcatc       600
     gcggtagagc ccaaagattc gcctgtcctc tcagggggga aaccgggtcc ccataagatt       660
     cagggaatcg gcgccggatt tgtcccgaat gttctgaata cgtcactcta caatgaggtc       720
     ataacggtaa gcaatgaaga cgcgattgcc gcttccaaag cattggcaaa aaccgaaggg       780
     cttcttgtgg gaatttcggc aggggccaat gtccacgcag ccgctctggt agccgcacgt       840
     cccgagaaca aaggaaaaac catcgtaacg attctgtgcg atacggcaga acgttatctg       900
     agtacacctc tgtttgaatc gtaa                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page