(data stored in ACNUC7421 zone)

EMBL: CP002355.PE512

CP002355.PE512       Location/Qualifiers
FT   CDS_pept        490663..492120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0513"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /EC_number="6.4.1.1"
FT                   /note="COGs: COG4770 Acetyl/propionyl-CoA carboxylase alpha
FT                   subunit; InterProIPR005481: IPR005479: IPR005482:
FT                   IPR011761: IPR 011764; KEGG: abu:Abu_0605 acetyl CoA
FT                   carboxylase, biotin carboxylase subunit; PFAM:
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; SPTR: Acetyl CoA
FT                   carboxylase, biotin carboxylase subunit; PFAM:
FT                   Carbamoyl-phosphate synthase L chain, ATP binding domain;
FT                   Biotin carboxylase C-terminal domain; Carbamoyl-phosphate
FT                   synthase L chain, N-terminal domain; TIGRFAM: acetyl-CoA
FT                   carboxylase, biotin carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33180"
FT                   /db_xref="GOA:E4U015"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E4U015"
FT                   /protein_id="ADR33180.1"
FT                   /translation="MKTKKISKVLIANRGEIALRIIRACKELGIKSVVVFSEVDVNGVW
FT                   VRKADECYPIMGDPIAAYLDYERIISLAKKADCDAIHPGYGFLSESAEFAQACIDNGII
FT                   FIGPKPEHIALFGDKMASKVAMREVGVPMLPGTDEPIDNIEDAEKIAIDIGFPIIIKAA
FT                   FGGGGRGMRIVEKAEDFKEMYESATNEALRFFSRGEVFIEKYLKNPRHIEIQIVADKYG
FT                   NIVHLGDRDCSIQRRHQKVIEIAPSPLLNHETRRELYRISKKAMYRLGYESVGTIEYLV
FT                   DQDDNIYFIEMNTRVQVEHPVTEAISGIDLIQRMIQIAEGDQLKFMQEEIHLRGYAIEF
FT                   RINAENPKLGFVPSPGLITNYLAPGGPGVRLDSMAYTNYQIPSNYDSMIGKLIVTALTW
FT                   EDAVRKAARALDEFLIEGVPTNIPLHRQIVRDQDFIDGKIDTGYLDTKLQHFNLDAIHN
FT                   MDDEEAKMQHITAVIEAINKNNLNVRH"
     gtgaaaacta aaaagatcag caaagtattg atcgcgaacc gtggtgaaat cgcacttcgt        60
     attattcggg cttgtaaaga gttagggatt aaaagtgttg ttgtgttttc agaagtagac       120
     gtcaatggtg tttgggttcg taaagctgat gagtgttatc cgattatggg tgatccgatt       180
     gccgcgtatc ttgattatga gcgtattatc tctttggcga aaaaagccga ttgtgatgcg       240
     atccatcctg gatacggatt tttatcggaa agtgccgaat tcgcacaagc gtgtatcgat       300
     aacggaatca tcttcatcgg accgaaaccg gaacatatcg cccttttcgg ggataaaatg       360
     gcctctaaag tagctatgcg agaagtgggt gttccgatgt tgccgggtac tgacgagccg       420
     atcgacaata tcgaggatgc ggaaaaaatc gcaatcgata tcggatttcc gatcattatc       480
     aaagcagctt tcggcggcgg cggacgtggt atgcgtatcg ttgaaaaagc cgaagatttc       540
     aaagagatgt acgagtcggc aaccaacgaa gcattgcgtt tcttcagccg cggtgaggtt       600
     ttcatcgaaa aatacctcaa aaacccgcgt catatcgaga tccaaatcgt agcggacaaa       660
     tacggcaaca tcgtccattt gggagatcgt gactgctcaa ttcaacgccg tcaccaaaaa       720
     gtgatcgaaa ttgccccttc accgctcttg aaccatgaaa ctcgccgtga gctttaccgt       780
     atttccaaaa aagcgatgta ccgtctcgga tacgaaagtg tcggtacgat cgagtatctg       840
     gttgaccaag acgataacat ctatttcatc gaaatgaata cccgtgttca agtggaacat       900
     ccggttaccg aagcgatttc gggaatcgat ttgattcaac gtatgatcca aattgcagag       960
     ggcgatcagc ttaaattcat gcaagaggaa attcaccttc gcggatacgc gatcgaattc      1020
     cgtatcaatg ccgaaaatcc taagttggga tttgtccctt cgccgggtct tattaccaac      1080
     taccttgcac cgggcggtcc gggggtacgt ttggactcta tggcgtatac caactatcaa      1140
     atcccttcca actacgattc aatgatcggt aaattgatcg ttacggcatt gacatgggaa      1200
     gatgcggtgc gcaaagcggc tcgtgcattg gatgagttct tgattgaggg ggttccgacg      1260
     aatatccctc ttcatagaca aatcgtccgt gaccaagatt ttatcgacgg taaaatcgat      1320
     accggatacc ttgataccaa attgcagcac tttaacctcg atgcgatcca caacatggat      1380
     gacgaagagg cgaaaatgca acatatcact gccgtcatcg aagcgatcaa caaaaacaat      1440
     ctcaacgttc gccactaa                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page