(data stored in ACNUC7421 zone)

EMBL: CP002355.PE514

CP002355.PE514       Location/Qualifiers
FT   CDS_pept        493437..493703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0515"
FT                   /product="protein translocase subunit yajC"
FT                   /note="COGs: COG1862 Preprotein translocase subunit YajC;
FT                   InterPro IPR003849; KEGG: tdn:Suden_1576 preprotein
FT                   translocase subunit YajC; PFAM: YajC family protein; SPTR:
FT                   Preprotein translocase, YajC subunit; TIGRFAM: preprotein
FT                   translocase, YajC subunit; PFAM: Preprotein translocase
FT                   subunit; TIGRFAM: preprotein translocase, YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33182"
FT                   /db_xref="GOA:E4U017"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:E4U017"
FT                   /protein_id="ADR33182.1"
FT                   /translation="MEILSQILPFVFLIAIMYFVIIRPQNQQAKKHKEMIEALTKGDKI
FT                   ITTGGLIVEIKKVEDKFFMIKMNNETEARLVKDAVARKYEDEA"
     atggaaattc tttcccaaat tctcccattt gtctttttga tcgctattat gtattttgtg        60
     atcattcgtc ctcaaaacca acaggctaaa aagcataaag agatgatcga agctctcaca       120
     aaaggggata aaatcatcac taccggcgga cttatcgtcg aaatcaaaaa agtcgaagat       180
     aaattcttca tgattaaaat gaataatgag accgaagcgc gactcgtcaa agatgcggtt       240
     gccagaaagt acgaggatga agcttaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page