(data stored in ACNUC7421 zone)

EMBL: CP002355.PE515

CP002355.PE515       Location/Qualifiers
FT   CDS_pept        493693..495270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0516"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="COGs: COG0342 Preprotein translocase subunit SecD;
FT                   InterPro IPR005791: IPR003335: IPR001036; KEGG:
FT                   tdn:Suden_1575 preprotein translocase subunit SecD; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; SPTR:
FT                   Protein-export membrane protein SecD; TIGRFAM:
FT                   protein-export membrane protein SecD; protein-export
FT                   membrane protein, SecD/SecF family; manually curated; PFAM:
FT                   Protein export membrane protein; SecD/SecF GG Motif;
FT                   TIGRFAM: protein-export membrane protein SecD;
FT                   protein-export membrane protein, SecD/SecF family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33183"
FT                   /db_xref="GOA:E4U018"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:E4U018"
FT                   /protein_id="ADR33183.1"
FT                   /translation="MKLNYRVVLLIIATVFGLIFSLPSFTQSSEGKKITLGLDLQGGLH
FT                   MLLGVKTEEAVNSQIKSIASGVKHFAERNDILIEGISVREGKVVFELLDGDDATTMDEH
FT                   LKTIEGTVVHASEGKYAISITPEAVEKLKLQAVDQAIETIRNRLDQFGLAEPTVAKQGI
FT                   DKILVELPGIKTAEEEQRARELISRAAKLELMAVDEDRSMRVNDLSEAEAASYGDRILE
FT                   DALQPQMKHLVNEIPILDGTMLTDAQVGYDQNNRPVINFSLNSAGAQVFGDFTGKSVGK
FT                   RLAIVLDGKVYSAPVINERIGGGSGQISGNYTVAEANDLAIALRSGALLAPIYMLEKRS
FT                   VGPSLGADSIKASLLALVSGFVLVMIFMIMYYGLAGIIANLAVVINIFIILAMMALLGA
FT                   TLTLPGMAGIVLHIGLAVDANIIINERVREQIRLGIGLKRALHEGYSKAMRAILDSNIT
FT                   QIIACTILYVYGTGAIKGFAVTLSMGILASMLTAIVGTYGIFQLFTNRIEKSKNYKMWF
FT                   GMTRKVNA"
     atgaagctta attatcgcgt tgttttactg attatcgcca ctgtatttgg tctgatcttt        60
     tctctcccgt catttactca aagctccgaa gggaaaaaaa ttaccctcgg acttgatttg       120
     caggggggat tgcatatgct tttaggggtt aaaaccgaag aagcggtcaa ttctcaaatc       180
     aaatcaatag catcgggtgt caaacatttc gccgagcgta atgacatttt gattgaaggt       240
     atcagtgttc gagaagggaa agttgtattt gaacttttag atggtgatga tgcgacgact       300
     atggatgaac atctcaaaac gattgagggg acggttgttc atgcttctga ggggaaatac       360
     gctatttcaa tcacccctga agcagttgaa aaactaaaac ttcaagcggt ggatcaggct       420
     attgagacga tccgtaaccg acttgatcag ttcggactgg ctgaaccgac cgttgcaaaa       480
     caggggatcg ataaaattct cgtagaactt cctgggatca aaaccgctga agaagagcag       540
     cgtgcacgcg agttgatctc ccgtgcggca aagctcgaac tgatggcggt ggatgaagac       600
     cgctccatgc gggtgaatga tctcagcgaa gcggaagcgg caagctacgg agatagaatc       660
     ctcgaagatg cccttcagcc gcaaatgaaa catttggtga atgaaatccc gattttggac       720
     gggacaatgc tcaccgatgc acaagtggga tacgaccaaa acaaccgtcc cgtgattaac       780
     ttttcgttga attctgccgg tgcgcaagtt ttcggtgatt ttaccggtaa aagtgtcggt       840
     aaacggcttg cgatcgtatt ggacgggaaa gtttattcgg ctccggtcat taatgaacgt       900
     atcggcggcg gaagcgggca gatcagcggt aactatacgg ttgccgaagc aaatgacctt       960
     gctatcgcct tgcgttcggg agccttgctg gctccgatct atatgttgga aaaacgctct      1020
     gttggaccga gtctgggagc cgacagtatt aaagcttctt tgctcgcttt ggtgagcgga      1080
     tttgtccttg tcatgatttt tatgatcatg tattatgggt tggccggtat tatcgccaat      1140
     cttgccgttg taattaatat ctttattatt ttggcgatga tggcactgct cggtgcgaca      1200
     ttgacattgc cggggatggc gggtatcgtg ctgcatatcg gtttggcggt tgatgccaat      1260
     attatcatca atgaacgtgt tcgtgaacag atacgtttgg gaatagggct taagcgggca      1320
     ttgcatgagg gatacagcaa ggcgatgcgg gctattttgg attctaatat tacgcagatt      1380
     attgcctgta cgatcctcta tgtgtatgga accggtgcga ttaaagggtt tgccgtaacg      1440
     ctcagtatgg gtattttagc ctctatgttg accgcgattg tcggaactta cgggattttc      1500
     caacttttta ccaatcgtat tgaaaaatcg aaaaactaca aaatgtggtt tggaatgacg      1560
     agaaaggtga atgcataa                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page