(data stored in ACNUC7421 zone)

EMBL: CP002355.PE516

CP002355.PE516       Location/Qualifiers
FT   CDS_pept        495270..496241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0517"
FT                   /product="protein translocase subunit secF"
FT                   /note="COGs: COG0341 Preprotein translocase subunit SecF;
FT                   InterPro IPR005665: IPR003335; KEGG: wsu:WS1247 preprotein
FT                   translocase subunit SecF; PFAM: SecD/SecF/SecDF export
FT                   membrane protein; SPTR: PROTEIN-EXPORT MEMBRANE PROTEIN
FT                   SECF; TIGRFAM: protein-export membrane protein SecF;
FT                   protein-export membrane protein, SecD/SecF family; PFAM:
FT                   Protein export membrane protein; SecD/SecF GG Motif;
FT                   TIGRFAM: protein-export membrane protein, SecD/SecF family;
FT                   protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33184"
FT                   /db_xref="GOA:E4U019"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:E4U019"
FT                   /protein_id="ADR33184.1"
FT                   /translation="MELFKEDKVYNFLGKGKIFFVASFVLFFLAIALIATKGFSFGIDF
FT                   TGGTVVQVKYQGPAPIDKVREALEKDELFKHAAVSEFGSPEEIVIKTAASTDGLSKDIG
FT                   DVTREILKGTGEFEIRRVDMVGPKVGDELRVKGLTAFLLTLGAIMAMVTFRYEWRFALA
FT                   AIIAIVHDIVITFGFVSYFEIDFNIESVAALLMILGYSIHDTIIVYDRIREHIQESKNS
FT                   DFVMIVNEAVSRTQSRTTLTSLTVFFVVLTLFLFGGDIMLGFSFPMLVGVIIGTYSSIF
FT                   VAAQLVVWTGFSVGRYREKMAEKQKMQAEKEKMRAQFEQGIV"
     atggaattgt ttaaagaaga taaagtctat aacttcctag gcaaagggaa aatctttttt        60
     gtcgcatcgt ttgtcctttt ctttttagcg attgctctta tcgcgaccaa agggttttcc       120
     ttcggtatcg attttaccgg agggacggtt gttcaggtca aatatcaagg tcctgctccg       180
     atcgataaag tgcgtgaagc acttgaaaaa gatgaactct ttaaacacgc tgcggtcagc       240
     gaattcggtt cccctgaaga aatcgttatc aaaacagcgg cttcgacgga cggattgagt       300
     aaagatatcg gagacgttac gagagagatt ctcaaaggga cgggtgagtt cgaaatccgc       360
     cgtgtcgata tggtcgggcc gaaagtagga gatgaactcc gggtcaaagg gcttaccgcg       420
     tttcttttga cgctgggtgc gattatggcg atggtaacgt ttcggtatga atggcgtttc       480
     gcgttagcgg ccatcatcgc gattgtgcat gatatcgtta ttacatttgg atttgtctct       540
     tattttgaga tcgatttcaa tatcgagagt gttgcggcgc tgttgatgat tttagggtac       600
     tcgatccatg atacgattat tgtctacgac cgtatccgtg aacacatcca agaatctaaa       660
     aacagcgatt ttgtgatgat cgtcaatgaa gcggtatccc gtacccagtc tcgtacgaca       720
     ttgacatcgt tgacggtctt tttcgtcgta ttgaccctgt tcttgttcgg cggagacatt       780
     atgctcgggt tcagcttccc gatgctggtc ggtgttatta tcggaacgta tagttcgatt       840
     ttcgttgcgg cacagcttgt tgtttggacg ggattcagtg tcgggcgtta tcgtgaaaag       900
     atggctgaaa aacagaaaat gcaagctgaa aaagagaaaa tgcgtgctca atttgagcag       960
     ggcattgttt aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page