(data stored in ACNUC7421 zone)

EMBL: CP002355.PE518

CP002355.PE518       Location/Qualifiers
FT   CDS_pept        498722..499219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1463 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33186"
FT                   /db_xref="UniProtKB/TrEMBL:E4U021"
FT                   /protein_id="ADR33186.1"
FT                   /translation="MKYWILSALIFLAGCGYQPSSHLAKNVVGDSVSTEVVIRMEDPQN
FT                   TVIIKDAVDMAVITRFRTALVPKNVSHTHLKIMINSVSFSPLRYDTNGYIITYRTAVVM
FT                   GISRTTAGKTANYTTSGVYDFDIEPNAIISDQARFEAIRQGAQKGIDVFIAQVSAQGSD
FT                   SK"
     gtgaaatact ggatactgag cgcattgatc tttttagccg gctgcggtta tcagccttcg        60
     agccatttgg ctaaaaatgt tgtgggcgac agtgtcagta ccgaagtggt aattaggatg       120
     gaagaccctc aaaataccgt tattataaaa gatgccgtcg atatggcggt tattacgaga       180
     tttagaacgg cactcgttcc taaaaatgtt tcgcataccc atttgaaaat aatgataaat       240
     tccgtatctt tcagtcctct ccggtacgat actaacggct atatcataac ctaccgcacc       300
     gcggttgtaa tgggaatcag ccgtacgacg gcgggcaaaa cggcgaatta tacgaccagc       360
     ggggtatatg atttcgatat tgaaccgaat gctattattt ccgatcaggc acgttttgaa       420
     gcgatccgtc aaggggcaca aaaagggatt gatgttttca tagcacaggt atcggcacag       480
     ggttctgact cgaaataa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page