(data stored in ACNUC7421 zone)

EMBL: CP002355.PE519

CP002355.PE519       Location/Qualifiers
FT   CDS_pept        499229..500764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0520"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG3706 Response regulator containing a
FT                   CheY-like receiver domain and a GGDEF domain; InterPro
FT                   IPR000160; KEGG: tdn:Suden_1570 diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; SMART: GGDEF domain
FT                   containing protein; SPTR: Diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain; TIGRFAM:
FT                   diguanylate cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADR33187"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E4U022"
FT                   /protein_id="ADR33187.1"
FT                   /translation="MTINQIVRNTVERLKAEGKVWTPDVYAETFCAEAKKAGFAVEDCS
FT                   GIDRYVALMDKKTLDEIKQYRVRTTAELIRFLISKLSRMNPNEATILVELLSGLAKKMA
FT                   QSIDLLHNPDASALAKKTIAILESQGGSTQIDLLKQAWTNFLSVYDDSFLMKLAHFGSV
FT                   DSTNLRSTIEGLKFKTSQGGGVDYDRTIRILISSLVPSIAPTMDDTTIELSQKLHSNPA
FT                   YIATDECEKEIKTAIAMRIALDKHSVEEMVHALDVLLDKLSVQLIDLIERSESSSSEIR
FT                   EVKRDLEALESHKPADFKTAHKRLYTIASTLEERVEVLSKDLKVHNEKVNQMGKKIATL
FT                   EAELAQATQASREDFLTKLFNKRAIEEYLNLKEAEYERHGHSFCVAMLDLDHFKAVNDT
FT                   YGHEAGDAVLIAFAKILKLEARNSDIVGRYGGEEFLAILGDTDLEGAKIFCEKVRAHVE
FT                   QAHFMYQGQRIAVSISIGVAQRSNFPSLKALISGADERLYDAKRKGRNRVEPA"
     atgaccatta accaaattgt tcgaaatacg gtcgagaggc ttaaagcgga agggaaagtg        60
     tggactcccg acgtctatgc cgagacattt tgtgctgaag ctaaaaaagc gggatttgcg       120
     gtcgaagact gcagcggaat agaccgctat gtcgctttga tggataaaaa aacactcgat       180
     gagatcaaac aataccgtgt tcggacaacg gctgaactga tccgattcct aatctccaaa       240
     ctgagccgca tgaaccccaa tgaagcgacg attttggtcg aactcctaag cggcctcgcc       300
     aaaaaaatgg cgcaaagcat cgatttgctg cacaatccgg atgcttccgc attggcaaaa       360
     aagacaatcg ccattctcga gtcccaagga ggatcgacgc aaatcgatct gcttaaacag       420
     gcatggacaa attttctttc cgtttacgac gattcgtttt taatgaaact ggctcatttc       480
     ggttcagtcg actcgaccaa tttacgaagc acgattgagg ggcttaagtt caaaacgagc       540
     caaggaggag gggttgatta tgatagaacg attcgtattc tcatctcttc attggtccct       600
     tccatcgccc ccactatgga cgatacgaca atagaactct cccagaaact tcatagcaac       660
     ccggcgtata tcgcaaccga tgagtgcgaa aaagagataa aaactgcgat tgcgatgcgt       720
     atagccctcg ataaacacag tgtggaagag atggttcacg cacttgatgt actcctagat       780
     aaactttcgg tacaactcat tgatttgatc gagagaagcg aaagctcaag cagtgaaatc       840
     cgggaagtaa aacgtgatct tgaagcgctt gagagccata agcctgctga ttttaaaacc       900
     gctcacaaac ggctctatac tattgccagt acactggaag aaagagtaga agtgttgagc       960
     aaagatttaa aagttcataa tgaaaaagtg aatcagatgg ggaaaaagat cgctactctg      1020
     gaggcggaac tggcgcaggc gactcaggcg tcacgggaag actttttgac gaaacttttt      1080
     aacaaacggg cgattgaaga gtatctgaat ttgaaagagg ccgaatatga gcgccacgga      1140
     cattcgtttt gcgttgcgat gctcgatttg gaccatttta aagcggttaa cgatacctac      1200
     ggccatgaag caggggatgc ggtgctgatc gcatttgcca aaatcttgaa attggaagcc      1260
     cgaaacagcg atatcgtcgg acgctacgga ggggaagaat ttttggctat tttgggagat      1320
     accgatttgg aaggggcgaa aatcttttgc gaaaaagtac gtgcccatgt cgagcaggcc      1380
     cattttatgt atcaggggca gcggatagcc gtcagtataa gtatcggtgt cgcacagcgt      1440
     agtaactttc cttcattgaa agcattgata agcggtgcgg atgagcggct gtatgatgct      1500
     aagcgtaaag ggcgaaaccg cgtcgagcct gcatga                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page