(data stored in ACNUC7421 zone)

EMBL: CP002355.PE52

CP002355.PE52        Location/Qualifiers
FT   CDS_pept        49637..51085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0052"
FT                   /product="cytochrome c oxidase accessory protein CcoG"
FT                   /note="COGs: COG0348 Polyferredoxin; InterPro IPR017900:
FT                   IPR014116: IPR017896; KEGG: tdn:Suden_2030 4Fe-4S
FT                   ferredoxin, iron-sulfur binding; SPTR: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding; TIGRFAM: cytochrome c oxidase
FT                   accessory protein CcoG; PFAM: Ubp3 associated protein Bre5;
FT                   TIGRFAM: cytochrome c oxidase accessory protein FixG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32720"
FT                   /db_xref="GOA:E4TWA4"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA4"
FT                   /protein_id="ADR32720.1"
FT                   /translation="MSNETTPTGKEYLSGWTPWRIKRYWFYGLVTIISLVIPWITINGN
FT                   HLFLLSFDKLKLHLMFVQFDMQELYLMPFLLMILFIGIFGITVLGGRVFCGWICPQTIF
FT                   RVVYRDLIETKLLGLRKRIKNKQQEPDYSKPENKLKRLVAILLWTGLAFIAASDLMWYF
FT                   VPPEDFLAYIQNPAEHTVLIGSILGIVAFLVYDVIFLKENFCVYVCPYSRIQSVLYDDD
FT                   TVMAIYNPNRGGDIYNEHKEKIFTKQNDLLSVNPKAECTTCESCVTVCPTHIDIRKGLQ
FT                   LECINCLECVDACTEVMGKLGKPSLVEWSSEKETLFMKGKTQYFRPKILGYITVLVVVS
FT                   IILAMMGSKKEYMLLNINKENRLYSIHNDDGKVKVENAYTFLLQNTLNEDHDYYFDVVA
FT                   PAGMEGKIKIEEPEEAFTVKPGVVKKKVVVLYTDEILVNDERKDTVIPITINAYAVDAK
FT                   DKVAVTRQSTFTFPRADLLKEEED"
     atgagcaatg aaacaacccc gacagggaaa gagtatttgt ccggatggac accttggcgt        60
     atcaaacggt actggtttta cggtttggta accattatat ctctggtaat cccatggatt       120
     accattaacg gcaaccacct tttcttgctg agttttgaca aactcaaact ccatttgatg       180
     tttgttcaat ttgatatgca agaactttat ttgatgccgt ttttattaat gattttgttc       240
     atcgggatat tcggtattac cgtattgggt ggacgggttt tttgcggatg gatatgtccc       300
     caaaccattt tccgcgtcgt ttaccgtgat ttgatcgaaa cgaaactctt agggcttcgt       360
     aaacggatta aaaataaaca acaagagccg gattattcaa aaccggaaaa taaactcaaa       420
     cgccttgtcg caattttgct gtggaccggt ttggcattta tcgcggcatc ggatttaatg       480
     tggtatttcg taccgccgga agacttctta gcttatatcc aaaaccctgc cgagcatacg       540
     gttctgatcg gttctatctt gggtatcgtc gcttttttag tttatgacgt catcttcctg       600
     aaagagaatt tttgtgtcta tgtttgccct tattcacgta tccaatcggt tttgtacgat       660
     gatgataccg ttatggcgat ctataatcca aaccgcggcg gcgacatcta taatgagcat       720
     aaagaaaaaa tcttcacaaa acaaaacgat ctgttaagtg tcaatccaaa agcggaatgt       780
     actacctgcg aaagctgtgt gaccgtatgt cctacccaca ttgatatccg caaagggctg       840
     cagctggagt gtatcaactg tctagaatgt gtcgatgcgt gtaccgaagt catgggtaaa       900
     ctcggcaaac caagcctagt cgaatggtca agtgaaaaag agaccctgtt tatgaaagga       960
     aaaacccagt atttccgtcc aaaaatttta gggtacatca ccgtattggt cgtcgtcagt      1020
     attattttgg caatgatggg aagcaaaaaa gagtatatgc ttcttaatat caacaaagag      1080
     aaccgtttgt actccatcca taacgatgac ggaaaagtca aagttgagaa tgcatatacg      1140
     ttcttactgc aaaacacatt gaatgaagac cacgattact attttgacgt tgtcgcccct      1200
     gctgggatgg aaggcaaaat caagatcgaa gaaccggaag aagcctttac ggttaaaccg      1260
     ggcgtcgtta agaaaaaagt cgttgtcctt tacacagacg agatcctcgt gaatgacgaa      1320
     cgtaaagata cagtgattcc tatcaccatt aacgcttacg cggttgatgc aaaagataaa      1380
     gtggcggtta cacgtcaatc gacctttact ttcccacgtg ccgatttatt aaaagaagaa      1440
     gaggattaa                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page