(data stored in ACNUC7421 zone)

EMBL: CP002355.PE53

CP002355.PE53        Location/Qualifiers
FT   CDS_pept        51150..52370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0053"
FT                   /product="HI0933 family protein"
FT                   /note="COGs: COG2081 flavoprotein; InterPro IPR004792:
FT                   IPR013027; KEGG: tdn:Suden_0754 HI0933-like protein; PFAM:
FT                   HI0933 family protein; SPTR: HI0933-like protein; PFAM:
FT                   HI0933-like protein; TIGRFAM: flavoprotein, HI0933 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32721"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA5"
FT                   /protein_id="ADR32721.1"
FT                   /translation="MKTVAIIGGGASGLMAGLFAARAGANVTLYEQNNGVGKKILASGN
FT                   GRCNIINTTSSADDFAGTDPHFVTYALKQLNFTYFEKLCLSMGLVLDIKEDGRCYPLSN
FT                   EAKSVLIALKSAASDAGVHIRTDNSVSDISKKDAQFIVETPTDKKYFDAVLIATGSEAA
FT                   PQLGASADGYRFAEKFGHEIVPTYPSLVQLHLNSKHHHKMAGVKTTAEVTLIIDGKSKE
FT                   KIQGDILFAAYGISGLAILDISQKASYALLNKQRVSISLNLLPRYDRQSLINIVEKLFA
FT                   SVPKHDVHTALCGLMPAKIATYLLDDAGIALSAPVSALNPKEIKKLSHLIGEWKFEVNG
FT                   THGFKHAEVSGGGVSTAQINNKTMESKLVEGLYFAGEVLDIVGKRGGYNFNFAWASGMI
FT                   AGKEMAK"
     atgaaaacag tagcaattat cggcggcggt gcgagcggac tgatggcggg gctttttgcg        60
     gcacgcgccg gtgcaaacgt cacactctat gagcaaaata acggtgtcgg taaaaagatt       120
     ttagcctccg gcaacggacg gtgcaatatc atcaacacga catcttcagc tgacgatttt       180
     gcagggactg accctcattt tgtcacctat gcactcaaac agctcaattt tacttatttt       240
     gaaaaacttt gcctgtcaat ggggttggtt cttgatatta aagaagacgg acgatgctat       300
     cctctctcca atgaggcaaa atcagtattg atcgcactca aaagtgcggc aagtgatgcg       360
     ggcgtccata tccgtaccga caattcggtg agtgacatat cgaaaaaaga tgcccaattt       420
     atcgttgaaa cacctacaga taaaaaatat tttgatgcgg tactgattgc tacaggctcc       480
     gaagcggcac cccagctggg tgcgtcggct gatggctatc gatttgccga aaagtttggg       540
     cacgaaattg tcccgactta cccctcattg gtgcagcttc atttaaattc aaaacatcac       600
     cataaaatgg caggggtcaa aacaacggcc gaagtaaccc tcatcatcga cggtaaatcc       660
     aaagaaaaaa tccaagggga catcctcttc gctgcgtacg gtatttctgg acttgctatc       720
     ctcgatatca gccagaaagc ttcctatgcc ctcctcaaca aacaacgtgt cagtatttcc       780
     ctcaatctcc tcccccgtta tgatcgtcaa agtctcataa atatcgtcga gaagctgttt       840
     gcatccgtac ctaagcatga tgtccatacg gcactctgcg gccttatgcc tgccaaaatt       900
     gcgacctatc ttctcgatga tgcgggtata gcactctccg cacccgtatc tgcgctcaat       960
     ccaaaagaga ttaaaaaact ctcccacctg atcggcgaat ggaaatttga ggtgaacggt      1020
     actcacgggt tcaaacatgc cgaagtgagc ggcggcggcg tatcaacagc ccaaatcaat      1080
     aataaaacaa tggaatcaaa actggtagag ggtctctatt ttgcgggaga agtactcgat      1140
     atcgtaggga agcgcggagg ctataatttt aactttgcgt gggctagcgg aatgattgcg      1200
     ggaaaagaga tggcaaaata a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page