(data stored in ACNUC7421 zone)

EMBL: CP002355.PE55

CP002355.PE55        Location/Qualifiers
FT   CDS_pept        54496..55902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0055"
FT                   /product="Flagellar hook-length control protein-like,
FT                   C-terminal domain"
FT                   /note="InterPro IPR021136; KEGG: tdn:Suden_0029 flagellar
FT                   hook-length control protein; PFAM: Flagellar hook-length
FT                   control protein-like, C-terminal domain; SPTR: Flagellar
FT                   hook-length control protein; PFAM: Flagellar hook-length
FT                   control protein FliK"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32723"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA7"
FT                   /protein_id="ADR32723.1"
FT                   /translation="MIVQSKENKSQGSLVDLLGGNTKNSSAAKSNDLFSKLLASIGIQG
FT                   KGDENKIVKTNDFKAVIDPKNKSAAIPTSTTELKASQMKELQTLLSGKEGKEATLVSTE
FT                   LLENMTNDQMRTLINRAKDYLKNEISAKSPEYQADPKSLPKTLGALVKLAEKLGLEPQS
FT                   ISLATIVNEPEEKASFSNELLSKPLFEAKAIAALPATVMEESAPIEAITQLLSELKNKE
FT                   QKNTKPLSTETSVQEKSDKAETQPLTTLLQAMDKKEEKTASTSVSEKVDPIKIASTPTA
FT                   ATNKTDALIALLKESNDAKEIKSESIKVEGESSKSLHVPKADSLEVKAKEAQQSMRHFA
FT                   SDLKEAVQEYKPPFTRLTMKLNPEKLGEVEVTLVQRGNNVHVNIQSNNANSVAFLAHNA
FT                   TELKAQLASQGIQNATMNFMSGGDSQNQQAGQQQQQGQQQRFRAYESFEELNLNEEQIS
FT                   ALEIIIPHYA"
     atgatcgttc aaagcaaaga aaataaatca cagggatcac tcgttgattt gctgggtgga        60
     aatacgaaaa actcttccgc agcaaaatca aatgatcttt tttcaaaact tttggcttct       120
     atcggtattc aaggcaaagg cgatgaaaat aaaattgtta aaacaaacga ttttaaagcc       180
     gttattgacc ccaaaaataa atcggcagcg attccgacaa gcaccacaga attaaaagct       240
     tcccagatga aagagttgca aacacttttg agcggaaaag aggggaaaga agcaacactt       300
     gtttcaaccg aactgctcga aaatatgaca aatgatcaaa tgcgcactct gattaatcgg       360
     gctaaagatt atctaaaaaa tgagatcagt gcgaaaagcc cggaatatca ggctgacccg       420
     aaatcgttgc cgaaaacatt aggcgctctg gttaaattgg ctgaaaaact tgggcttgaa       480
     ccgcaaagta tctctcttgc gaccattgta aacgagcctg aagaaaaagc ttctttctcg       540
     aatgaactgc tttcaaaacc tctctttgaa gctaaagcga ttgccgcact tcccgcaacc       600
     gtcatggaag agagtgctcc gatagaagcg attacacaac ttttaagtga attaaaaaac       660
     aaagagcaaa aaaataccaa gccgctttca acagaaacat ctgtgcaaga aaaatctgat       720
     aaagctgaaa cacagccgtt aaccacgctt cttcaagcca tggataagaa ggaggagaaa       780
     acagcttcga cttccgtttc tgaaaaagtt gatccgataa aaattgcttc gacgccaaca       840
     gcagcgacga ataaaaccga tgcactgatt gcccttttaa aagagagtaa tgatgcaaaa       900
     gagataaaat cagaatctat aaaagtggaa ggggaatctt ctaaatcttt gcatgtccct       960
     aaagccgact ctttggaagt aaaagcaaaa gaggcacagc aaagtatgcg ccattttgca      1020
     agtgacctca aagaagccgt tcaagagtac aaaccccctt ttacccgcct tacgatgaaa      1080
     cttaatcccg aaaaactggg agaagttgaa gtgacccttg tgcaacgggg caacaatgtc      1140
     cacgtcaata ttcagtccaa taatgccaac agtgtcgctt tcttggcaca taacgccacc      1200
     gaactcaaag cgcagcttgc gtctcagggg attcagaacg caaccatgaa ctttatgtcc      1260
     ggaggcgata gtcaaaatca gcaagcaggg caacaacagc agcaagggca acagcagcgt      1320
     ttccgtgcgt atgagtcgtt tgaggaactg aacctcaatg aagagcagat ttctgctctt      1380
     gaaattatta tcccgcatta cgcgtaa                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page