(data stored in ACNUC7421 zone)

EMBL: CP002355.PE56

CP002355.PE56        Location/Qualifiers
FT   CDS_pept        55918..56592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0056"
FT                   /product="flagellar hook capping protein"
FT                   /note="COGs: COG1843 Flagellar hook capping protein;
FT                   InterPro IPR005648; KEGG: tdn:Suden_0030 flagellar hook
FT                   capping protein; PFAM: flagellar hook capping protein;
FT                   SPTR: Flagellar hook capping protein; PFAM: Flagellar hook
FT                   capping protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32724"
FT                   /db_xref="GOA:E4TWA8"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA8"
FT                   /protein_id="ADR32724.1"
FT                   /translation="MAINAYGAYTTDAAYTGATTAATNEDKSSLGKDDFLKLLLLELKY
FT                   QDPTSPMDSEKILSQTSQLATLESTENTNKALETLAASLTSSMQYSGISAIGKMADTGS
FT                   NAIVKEKDTSATFEIYFPEKVASGKVNILDSAGKVLRSIEIAETAAGTAQYKWDGKDNG
FT                   GTLLEEGIYYVESTYTKTDGTSATARVGRYPIESIKFEGGTTYAKLGSSYVDFSTIKEI
FT                   TN"
     atggctatta atgcttatgg agcgtacaca acagatgccg catatacagg tgcgacgaca        60
     gctgctacaa acgaagataa aagttctttg ggaaaagatg attttctcaa actgctgcta       120
     ttggaactca aatatcaaga tccaacatct ccgatggata gtgagaaaat tttgtcccaa       180
     acgtcacagc tggctacgct tgaatcgaca gaaaacacga acaaagccct tgaaacgcta       240
     gcggcttcac tcacttcatc aatgcagtat tccggcatat ccgcaatcgg taaaatggcc       300
     gatacgggga gcaacgcgat tgtcaaagaa aaagatacga gtgcaacgtt tgaaatatac       360
     tttccggaga aggtagcaag cggaaaagtg aacattctcg atagcgccgg caaggttctt       420
     cgaagcatcg aaattgctga aactgcagcc gggacagccc aatacaaatg ggatggaaaa       480
     gataacggcg gaacgctttt ggaggagggg atttactatg ttgagtcaac gtataccaaa       540
     accgacggga cgagtgctac cgcgcgcgtc ggacgttatc cgatcgaatc gattaaattt       600
     gagggcggta ctacctatgc gaagctcgga tccagttatg tcgatttcag tacgattaaa       660
     gaaattacga actga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page