(data stored in ACNUC7421 zone)

EMBL: CP002355.PE57

CP002355.PE57        Location/Qualifiers
FT   CDS_pept        56601..57938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0057"
FT                   /product="flagellar hook-basal body protein"
FT                   /note="COGs: COG1749 Flagellar hook protein FlgE;
FT                   InterProIPR000276: IPR018268: IPR019776: IPR020013: IPR
FT                   001444: IPR010930; KEGG: tdn:Suden_0031 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1078 domain
FT                   protein; flagellar basal body rod protein; SPTR: Conserved
FT                   domain protein; TIGRFAM: flagellar hook-basal body protein;
FT                   PFAM: Flagella basal body rod protein; Domain of unknown
FT                   function (DUF1078); TIGRFAM: flagellar hook-basal body
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32725"
FT                   /db_xref="GOA:E4TWA9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWA9"
FT                   /protein_id="ADR32725.1"
FT                   /translation="MTQGYYTGISGIQANQYGLDVIADNLANTNTVGFRGSSTEFASLF
FT                   SEKLVSSGSAPTYDEIGAGTRLQATTMNTQNGSLLNTDRFNDLAINGNGWFGVVSGQDR
FT                   YFTRAGNFVLDEYQKTDGAANSSVGRLTTTEGMYVTGTMLNNFAYDSQYNYSAKSDVTD
FT                   TGAFKITASLNTVPLTDANEQGPIELPTRLAYPTEPTTSTKFYGNLGTDVAERTMSANA
FT                   ISPSNDQNRIKLVFTQSAVQPDQGVSWDVVATASSNDGTVLYDTQYGTAVFNEGGGLES
FT                   FSLPTINNDGAPVSVDLGSAFGGVISSAGPTISASSQSDGISGGTLNKYSINSDGIIVA
FT                   DFSNGKQSTIGRIAVYHFQNDQGLTRSGSTLFSQSDNSGNPMFWTDANGEAVTGTTISS
FT                   GHLENSNVRMEVGLTDMIVMQRAYQANAKTVTTVDEMIQKALSMRK"
     atgacacagg gatattatac gggaatttca ggtatccaag ccaaccagta cgggttggat        60
     gtcattgcag ataatttagc aaataccaat acggtcggtt ttcgcggctc gtctaccgaa       120
     ttcgcctctt tatttagtga aaagcttgtc agttccggtt ctgccccgac ttatgatgaa       180
     atcggtgcgg ggacaaggtt gcaagcgaca acaatgaata cgcaaaacgg atcgctgctc       240
     aacacggaca gatttaatga tttagctatc aacggaaacg gatggttcgg ggtagtttct       300
     ggccaagatc gttattttac ccgtgcggga aatttcgttc tggacgaata ccaaaaaacc       360
     gatggagccg ccaactcttc cgtcggccgt cttactacga cggaggggat gtatgtgacg       420
     gggacgatgc taaataattt cgcctatgat tcacaataca attactcggc aaaatcggat       480
     gtcactgata ccggagcctt taaaatcacc gcttcattaa atacggttcc tcttaccgat       540
     gcaaatgaac aggggccgat tgagctgcct acacgattgg catatccgac agagcctacg       600
     actagcacaa aattttacgg taatctcggt acggatgtcg ccgaacgcac catgagtgcc       660
     aatgccatca gcccctctaa tgatcaaaac cgtatcaagc ttgttttcac ccaaagtgcg       720
     gttcagccgg atcagggagt cagttgggat gttgtcgcta ccgcttcttc caatgacgga       780
     actgtgcttt acgataccca gtacggaacg gctgtattta acgaaggggg tggtttggaa       840
     tcgtttagcc tgccgacgat taataatgac ggagcacctg tgagtgttga tcttggcagc       900
     gcattcggcg gtgtgatctc cagcgcagga cctaccatat cggcttcatc gcaatctgac       960
     ggtatttccg gagggactct caataaatac agtatcaatt cggacgggat tatcgttgcc      1020
     gatttttcta acggaaaaca aagtaccatc ggccgaattg cagtgtatca ttttcagaat      1080
     gaccaagggt taacccgctc gggaagcact ctcttttccc aaagcgataa cagcggcaat      1140
     ccgatgtttt ggaccgatgc gaacggagaa gcggtaaccg gaacaacgat aagcagcggt      1200
     catctggaaa actcgaatgt tcgcatggaa gttgggctta ccgatatgat cgttatgcag      1260
     cgcgcttatc aggcgaatgc caaaacggtg acaacggtgg atgaaatgat ccaaaaagca      1320
     ctctcgatga gaaaataa                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page