(data stored in ACNUC7421 zone)

EMBL: CP002355.PE58

CP002355.PE58        Location/Qualifiers
FT   CDS_pept        57992..60268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0058"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="COGs: COG1749 Flagellar hook protein FlgE;
FT                   InterProIPR012835: IPR020013: IPR001444: IPR010810: IPR
FT                   011491: IPR010930; KEGG: tdn:Suden_0032 flagellar hook
FT                   protein FlgE; PFAM: flagellar basal body FlaE domain
FT                   protein; flagellar basal body rod protein; flagellin hook
FT                   IN repeat protein; protein of unknown function DUF1078
FT                   domain protein; SPTR: Flagellar hook FlgE; TIGRFAM:
FT                   flagellar hook protein FlgE; flagellar hook-basal body
FT                   protein; PFAM: Flagellin hook IN motif; Flagella basal body
FT                   rod protein; Domain of unknown function (DUF1078);
FT                   Flagellar basal body protein FlaE; TIGRFAM: flagellar hook
FT                   protein FlgE, epsilon proteobacterial; flagellar hook-basal
FT                   body proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32726"
FT                   /db_xref="GOA:E4TWB0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR012835"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB0"
FT                   /protein_id="ADR32726.1"
FT                   /translation="MLRSLFAGVTGLQAHQIAMDVESNNIANVNTIGYKYSRANFSDLL
FT                   AQTSQIATAPQGDIGGKNAVQVGLGTTISSVTRIMTQGSIQNTDKNTDVAIQGDGFFIV
FT                   SSDAGSTYKYSRSGDFKFDAAGNFVDNNGFVVQGWVRDEATGKVDSTAPISNINIPPGL
FT                   TTPANATADVVLKANLDSGETVETFNATNSMDSYNLEYASNYAVWQAAGFVPAVGGALP
FT                   APPNAATQALWYSAYTTRNANTNSAENMNVMFNEQGQSLTMQPNQGVWVSYKDSVTTIP
FT                   MVSAAGAFTFTLNGTTISGTTSGVTLADDAATVQQAINAQTANTGVSATVVGSNLVLTN
FT                   DNSRDSDGSATKNIVITGSNAGALALGFTNQSVITAYKYTYTTNAADATPLINSYAVPT
FT                   TSVPPADSNFTTTEQLRLLMETHAQYVSGSDPAGTVAPAGVNFATGIKIIINDRGQFEV
FT                   SNLSDGDANQENLKLQVTGYSDPAANVTKNERFTALMQSINGTVVEGSTGIRLSQSMNA
FT                   ATHSASIDVYDSLGSKHTLKMDFRKTSVDVVSGSTWSMKLSVPEPGEINTIAPINEFNG
FT                   QVRFGPDGALSSYTPTNITYTANNGSSPNQTINIKLGTANAFDGVTSFDATSGTSGISQ
FT                   DGFPGGDLVGIRIDQSGTLVGSFSNGRSFGLAQMGMAKFTNNEGLVSDGGNVYLQSANS
FT                   GDPIIGTAATAGRGFMQSSSLEASNVDLSKSLTQLIIIQRGYQANGKTITTSDTLLETL
FT                   LGIKR"
     atgttacgat cactcttcgc aggtgtaacc gggcttcaag cccatcagat agcgatggac        60
     gttgaatcca acaatatcgc taatgttaac acgatcggat ataaatattc tcgtgcaaat       120
     ttttccgatt tgttggcgca aaccagtcaa atcgcaaccg ctcctcaggg agacatcgga       180
     gggaaaaacg ccgtacaggt cgggttagga acaacgatca gttccgttac gcggattatg       240
     acgcagggtt cgattcaaaa taccgataaa aatacggacg tcgccattca aggggacggt       300
     ttctttatcg tcagttccga tgcggggagc acctataagt acagccgttc aggggatttc       360
     aaatttgatg cggccggaaa ttttgtagac aataacggat ttgtcgtcca aggatgggtt       420
     cgtgacgagg cgaccggtaa agtcgattct accgcgccta tctcaaatat taacatcccg       480
     cccggattaa cgacacctgc gaacgctacg gccgatgtcg tcctcaaagc caatctcgat       540
     tctggggaaa cggtagagac gtttaatgcg acgaattcga tggattctta taatctggaa       600
     tatgcgtcaa actacgctgt atggcaggcc gccggatttg ttcccgctgt agggggggca       660
     ttgccggcac cgcctaatgc agcgacacag gctctttggt acagcgccta cacgacacgc       720
     aatgccaata ccaatagcgc cgaaaatatg aatgttatgt ttaacgagca agggcagtct       780
     ctcactatgc agcccaatca gggggtctgg gtcagctata aagactccgt cactaccatt       840
     cctatggtct cagctgcagg tgcttttacc tttacgttaa acgggactac tatcagcggt       900
     acaacgagcg gggtaacttt agcagatgat gccgcgactg ttcagcaagc gatcaatgct       960
     caaacggcaa atacgggggt ttcggcgacg gtagtcggca gtaatctcgt attaaccaac      1020
     gacaactccc gtgatagtga cgggagtgcc acaaaaaata tcgttatcac cggatcaaat      1080
     gccggtgcac ttgctttagg attcacgaat caatcggtta ttacagccta taaatatacg      1140
     tatacgacca atgccgcgga tgcgacgcct ctcatcaatt cctatgcggt accgactacc      1200
     tctgtgccgc ctgcggatag caactttacg acgacagagc aactgcgatt gctgatggag      1260
     acccatgcgc agtatgtttc cggatccgat cctgctggaa ccgttgcacc tgcgggggtt      1320
     aattttgcca cgggtattaa aattattatt aacgatcgcg ggcaatttga agtcagcaat      1380
     ctaagtgatg gcgatgccaa tcaggaaaac ttgaagctgc aggtaaccgg atattctgac      1440
     cctgcggcca atgtcacgaa aaatgagcgt tttaccgcat taatgcaatc gattaacgga      1500
     acggttgtcg aagggagcac gggaattcgg ctctcccaaa gtatgaatgc ggcgacgcat      1560
     tcggccagta tcgatgtcta cgattctctg gggagtaaac ataccctgaa aatggatttt      1620
     cgcaaaacgt cggtggatgt ggtctccggt tcgacatgga gcatgaaact ctcggttccg      1680
     gaaccgggtg aaattaatac cattgctccg atcaacgaat ttaacggaca agtacgtttc      1740
     ggcccagacg gagcactctc ctcgtacacg ccgacgaata tcacctatac ggcaaataac      1800
     ggttcgtcgc cgaaccaaac gattaatatt aaattgggaa cggcgaatgc ctttgacggt      1860
     gttacgagct ttgacgccac ctccggcacc agcggtatca gtcaagacgg tttcccgggg      1920
     ggagatttgg tcggtatccg aatcgaccaa agcggtacgc ttgtcgggtc tttctctaac      1980
     gggcgttcgt tcggacttgc gcagatgggg atggcaaaat ttaccaataa cgaggggctg      2040
     gtgagtgatg gcggaaacgt ctatttgcaa tcggcaaact cgggtgatcc gattatcggt      2100
     acggcggcaa cggcagggcg cggttttatg cagtcatcgt cgcttgaagc atcaaacgtc      2160
     gacttgtcca aatcgctaac gcagcttatt attattcaac gtggctatca agccaacggt      2220
     aaaacgatta ccacttccga tactcttctc gaaactcttc tgggaatcaa acgctaa         2277
//

If you have problems or comments...

PBIL Back to PBIL home page