(data stored in ACNUC7421 zone)

EMBL: CP002355.PE59

CP002355.PE59        Location/Qualifiers
FT   CDS_pept        60578..61084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0059"
FT                   /product="RDD domain containing protein"
FT                   /note="InterPro IPR010432; KEGG: tdn:Suden_1918 RDD
FT                   protein; PFAM: RDD domain containing protein; SPTR: RDD
FT                   protein; PFAM: RDD family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32727"
FT                   /db_xref="GOA:E4TWB1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB1"
FT                   /protein_id="ADR32727.1"
FT                   /translation="MRWRTLKQTNKIKTPVKPKIDYAPFWSRAAGFATDIFMIGLPISL
FT                   ITMMMFGYDQMHTAGGLDVLVHDPKAQTNPPNPIASLLQIALFLITYVWFWHKSGQTPG
FT                   KKLARIRVVDAKTMDNASYWKLSLRFIGYFFSFITLVGFFIGLLRKDKRALHDLISGTA
FT                   VIRVP"
     atgagatggc gaacattaaa acaaacaaac aaaataaaaa ctcccgttaa accgaaaatc        60
     gactatgctc ccttttggtc ccgtgctgca ggatttgcga ccgatatttt tatgatcgga       120
     ctgcctatat cacttattac gatgatgatg ttcggttacg atcagatgca caccgccggc       180
     ggattggacg tgttagtcca cgatccgaaa gcgcagacca atccgcctaa tccgatagca       240
     tcgctgctgc aaatcgctct ttttctcatt acctacgttt ggttttggca taaaagcggt       300
     caaacgcccg ggaaaaagct cgcccgtatc cgtgtagtgg atgccaagac catggacaat       360
     gcctcgtatt ggaaactctc cctccgtttt atcggttatt ttttttcctt cattacccta       420
     gtgggatttt ttatcgggct gttgcgcaaa gacaaacgtg ctttgcatga tctcatcagc       480
     ggcaccgccg ttatacgcgt cccctaa                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page