(data stored in ACNUC7421 zone)

EMBL: CP002355.PE6

CP002355.PE6         Location/Qualifiers
FT   CDS_pept        complement(7049..7834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0006"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /EC_number="7.3.2.1"
FT                   /note="COGs: COG1117 ABC-type phosphate transport system
FT                   ATPase component; InterProIPR017871: IPR005670: IPR003439:
FT                   IPR015850: IPR 003593; KEGG: tdn:Suden_1887 phosphate ABC
FT                   transporter permease; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase; SPTR: Phosphate ABC transporter, ATP-binding
FT                   protein; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter; TIGRFAM: phosphate ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32674"
FT                   /db_xref="GOA:E4TW58"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW58"
FT                   /protein_id="ADR32674.1"
FT                   /translation="MASIIDIKEECALHVRNFEFTYKGASSPSLKKVSMPIAKNAVTAL
FT                   IGPSGCGKTTLLRAFNRMHDLYPGNTYNGEIEFEGRNILNPKEDLIFLRTKIGMIFQKP
FT                   TAFPMSIFDNVAYGMRLQGIKNKTELEGRVEKALQDAALWKEVSDRLKNDANGLSGGQQ
FT                   QRLCIARAIAVEPEVLLFDEPTSALDPISTQGIEKLVIELKERVSIIIVTHNMQQAARV
FT                   SDYTGFMYLGELIELGHTEELFVTPKEKLTQEYITGKFG"
     atggcaagca ttatcgatat caaagaagag tgtgcacttc atgtgcgtaa ttttgaattt        60
     acctataaag gtgcgtcatc acctagcctg aaaaaagttt cgatgccgat tgccaaaaat       120
     gccgttacag cacttatcgg accgtccggc tgtggtaaaa cgactctatt gcgcgctttt       180
     aaccgaatgc atgatcttta tcccggcaat acctacaacg gagaaatcga atttgaaggg       240
     cgcaatattt tgaatccgaa agaagatctt atctttttgc ggactaaaat cgggatgatt       300
     ttccaaaaac cgaccgcatt tccgatgtct atttttgaca atgtcgctta cggaatgcgt       360
     ttgcaaggta ttaaaaacaa aacggagctt gaaggacgtg tcgaaaaagc gcttcaggac       420
     gccgcattat ggaaagaggt cagcgaccgc ctcaaaaacg atgcaaacgg cctctcagga       480
     ggacaacagc agcgtttatg tatcgcccgc gccatcgcgg ttgagccgga agttttgtta       540
     ttcgacgaac cgacctcggc acttgatcct atttcgacac aggggatcga aaaacttgtt       600
     attgagttga aagaacgcgt ttcgatcatc atcgttaccc acaatatgca gcaggcggca       660
     cgtgtcagcg actatacagg atttatgtat ctgggagaat tgattgaatt aggacacacc       720
     gaagagctgt ttgtcacccc gaaagagaaa cttacccaag aatatatcac cggtaaattc       780
     ggttga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page