(data stored in ACNUC7421 zone)

EMBL: CP002355.PE63

CP002355.PE63        Location/Qualifiers
FT   CDS_pept        complement(63725..64087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0063"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000209; KEGG: tdn:Suden_0048
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: Domain of unknown function (DUF309)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32731"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB5"
FT                   /protein_id="ADR32731.1"
FT                   /translation="MATEPTGITESCEAFVLSISEGRYYDAHEDLEPLWYPRRFEDNNE
FT                   VRLWKGFINAAVSFELAKRGRKEASAKAWQTYLKYFSLLENLVTPHKELYVKIAKLLEK
FT                   KHGMLCASAALSRTQR"
     ttggcgacgg aacctacggg tataacagag tcgtgtgagg cgtttgtcct ctccatcagt        60
     gaagggcgtt attacgatgc gcacgaagac ttggaaccct tgtggtatcc gagacgtttt       120
     gaagataata atgaagtgcg gctttggaaa gggtttatta atgccgcagt cagtttcgaa       180
     ttggcaaagc gagggcggaa agaagcttcg gcgaaggcat ggcaaaccta tctgaaatat       240
     ttttctcttt tggaaaatct tgttaccccc cataaagaac tctacgttaa aatagcaaag       300
     ctactagaaa aaaagcacgg catgctgtgc gcgagtgccg cgctgagccg aacacagcgt       360
     tag                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page