(data stored in ACNUC7421 zone)

EMBL: CP002355.PE64

CP002355.PE64        Location/Qualifiers
FT   CDS_pept        complement(64063..64371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0049 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32732"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB6"
FT                   /protein_id="ADR32732.1"
FT                   /translation="MVDLSVDEWTQEEFLHNKQALESQGIKVLLIDTILSPIDGIETTL
FT                   YAPPLLKNEPEGSVFVFYCDTGKSSKERLKEFRAKFPNHVCISLRGGRGYWRRNLRV"
     atggtcgatt tgagtgtcga tgaatggacg caagaagagt ttcttcataa caaacaggcg        60
     ttagaatcgc aaggaataaa agtgctgctg atcgatacga ttctaagtcc gatcgatggg       120
     attgagacga ccctgtacgc acctccgctg cttaaaaacg agccggaagg gagcgtcttc       180
     gttttctact gtgacacggg aaaatcatcc aaagagcgac tgaaagagtt tagagcgaag       240
     tttccgaatc atgtatgtat cagtctgagg ggagggagag ggtattggcg acggaaccta       300
     cgggtataa                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page