(data stored in ACNUC7421 zone)

EMBL: CP002355.PE65

CP002355.PE65        Location/Qualifiers
FT   CDS_pept        64454..67276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0065"
FT                   /product="helicase domain protein"
FT                   /note="COGs: COG1204 Superfamily II helicase; InterPro
FT                   IPR014021: IPR001650: IPR014001; KEGG: tdn:Suden_1967
FT                   helicase-like; PFAM: helicase domain protein; SMART:
FT                   helicase domain protein; DEAD-like helicase; SPTR:
FT                   Helicase-like protein; PFAM: Helicase conserved C-terminal
FT                   domain; Mitochondrial degradasome RNA helicase subunit C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32733"
FT                   /db_xref="GOA:E4TWB7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041082"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB7"
FT                   /protein_id="ADR32733.1"
FT                   /translation="MAKKKKKMIKLNQSIRHFFGDEGFDEGIERVPTDVLVALAHTLGV
FT                   FNGTTDKTGLIKTFRRIWSEGESDNREMIVSFFKHEGKIYPNPKPKEKPHEREEKINEM
FT                   LEGFDITPEERRALHASFIDIRTRKITPEKIASKLEHIRYTRKREQLEKALEGKFNFDD
FT                   SLEYYASITYHIDTEIFTKIHILKTAPLNEKRLHEESIEVLVPEITELKTALTTQKQEQ
FT                   TNLFLSSLNLSDHRYLTKEQIIASLKSAPPSTQTYGTLSVEILRDVLARHLHTPLTSVT
FT                   NDDLIVEIDKQLHLPHRIEPLEYTLSLHLDIHELSRQIWNEEELTITTMVEEQSIQEER
FT                   IFLQELEHLVEECRTRSKLLEIDDESLYEIVYELLLPYLTLTPHISSKTSRRVLFAYDQ
FT                   RIAGELLKRQRQALLARTVRDFKNLFPLARSLRRRLIFHTGPTNSGKTYTAFQQLKKAG
FT                   TGYYLAPLRLLALEGYENLREQGVSASLITGEEQLLDEDATHISSTIEMLSFESEVDCC
FT                   VIDEVQMIDDRDRGWAWANAIIGAPAKTVIMTGSPNAKEAIIALAEYLGEPLEIIEFER
FT                   KNPLELLKSPTPITAIEPKTAVIAFTRSNALRLKQQLSKTYRTSVIYGNLSPEVRREEA
FT                   RRFREGETDILVATDAISMGLNLPIKTLLFSKADKFDGQNQRNLTATEVRQISGRAGRY
FT                   GLSEKGYVGALTADVLKTISSLFTKAIEPIVLPFNVMANFDHIMLVSNILEEKSLSNIV
FT                   DFFVRNMKFEGPFRAANLESMQEASAIVDRYDLDMRTKYTLATAPLSTSSPLVMAAFER
FT                   YVRALEQKKPIAYIPPQRLGLHALSMEELQEAEDRIKEISLYLWLSYRLGEFFVDAEKA
FT                   RTFRGELNRFIENSLQQSHFVPRCKTCGKPLAPNAEFSICQSCFNNLNRSKAQQARSNP
FT                   AEKKYSSKRR"
     atggcaaaga aaaagaaaaa aatgatcaaa ctcaatcaat ccatccgcca ttttttcggt        60
     gatgaaggat ttgacgaagg gatagaacgg gttccgaccg atgtgctcgt tgccctggcc       120
     catacgctgg gcgtatttaa cggaacgacc gataaaaccg gtttaatcaa aacgtttcgt       180
     cgcatatggt cggaagggga gagcgacaat cgtgagatga tcgtctcttt tttcaaacac       240
     gaggggaaaa tctaccccaa tccgaaaccc aaagagaaac cgcacgagcg ggaagaaaaa       300
     atcaacgaga tgctggaagg ttttgacatc acacccgaag agcgccgggc attgcatgct       360
     tcgtttatcg atatacgtac ccgaaaaatt acccccgaga aaatagcctc caagttggag       420
     cacatccgct atacacgaaa gcgcgagcag ctcgaaaaag cgttagaggg aaaattcaat       480
     ttcgacgatt cactggagta ttatgcttcg atcacttatc acatcgatac cgaaatattt       540
     acgaaaattc atatccttaa aaccgctccg ctgaatgaaa aacggctcca tgaagagagc       600
     atcgaggtat tggttccgga gattaccgaa ctaaaaacgg cactaacaac tcaaaaacag       660
     gaacaaacca atctgttttt atcctcgctt aatttatccg atcaccgcta tctaaccaaa       720
     gagcaaatta tcgcttcgct taaaagtgct cccccctcta cacaaaccta cggtaccctc       780
     agtgtagaga ttttacgcga tgttttggcg cgacatctgc acactcctct tacctcggtt       840
     actaacgatg atttgattgt tgagattgac aaacagcttc atctgccgca tcggatcgaa       900
     ccgctggaat atacgctgtc gcttcatttg gatattcatg agctgagccg acaaatctgg       960
     aatgaagaag agcttaccat tacaacgatg gtagaagaac aaagtattca ggaagagcgg      1020
     atttttttgc aagaacttga gcacctcgtc gaagagtgcc gcacccgctc aaaactttta      1080
     gagatcgatg acgaatcgct ttatgagatc gtgtatgaac tattgctccc ttatcttact      1140
     ctgacgccgc atatcagttc taaaacctct cgacgggtac tgttcgccta tgatcagcga      1200
     attgcggggg aactgctcaa acgtcagcgc caagcgctcc ttgcccgaac ggttcgcgat      1260
     tttaaaaacc ttttccctct ggcacgctcg cttcgacgac gccttatttt ccacacggga      1320
     ccgacgaaca gcggtaaaac ctatacggcg tttcagcagc tgaaaaaggc ggggacggga      1380
     tactatcttg ccccattgcg tttgttagcg ctggagggat atgagaacct tagagaacag      1440
     ggggtcagtg catcgttgat taccggagaa gaacagctcc tcgatgaaga cgcaacccac      1500
     atcagctcca ccatcgagat gctcagtttt gagagcgaag tcgactgctg cgttatcgat      1560
     gaggttcaga tgatcgatga ccgggaccgc ggatgggcat gggcgaatgc tattatcggt      1620
     gcccctgcca aaaccgtcat catgacggga tcaccgaatg caaaagaggc gattatcgca      1680
     ttggccgaat atctgggcga gccgctggag ataatcgaat tcgaacgtaa aaatccattg      1740
     gaacttttga aatcaccgac gccgatcacc gcgattgagc cgaaaaccgc cgttatcgcg      1800
     tttacccgtt ccaacgctct tcgtttgaaa cagcagcttt caaaaacgta tcggaccagt      1860
     gttatctacg gaaatcttag ccctgaagta cgccgggaag aggcgcgccg tttccgcgag      1920
     ggtgagactg atattctagt cgccaccgat gcgatcagca tggggctgaa tttgccgatc      1980
     aaaacactgc tgttttccaa agcggacaaa tttgacggcc agaaccagcg caatctcacc      2040
     gctaccgaag tgcggcagat ttcgggcagg gcagggcgct acggactgag tgagaaggga      2100
     tatgtcgggg ctctcaccgc cgatgttctt aaaacgatca gttccctttt taccaaagcg      2160
     atcgaaccga ttgtattgcc gtttaacgtg atggccaact ttgatcacat catgctcgtt      2220
     tccaatattt tggaagaaaa atctctctca aatatcgtcg atttctttgt ccggaacatg      2280
     aaattcgaag ggccgttccg tgcagcgaat ctcgaatcga tgcaggaagc ttccgctatc      2340
     gtagaccgct acgatctgga tatgcggacc aaatacaccc ttgcgaccgc acccctttca      2400
     acctcatcgc ctttggttat ggcggcattt gaacgctatg tcagggcact agagcagaaa      2460
     aaaccgatcg cctatattcc cccgcagcgt ttgggacttc atgcactatc gatggaagag      2520
     cttcaagaag cggaagatcg gatcaaagag atcagtctct atttatggct ttcatatcgt      2580
     ttgggagaat tttttgttga tgcggagaaa gcgcggacat ttcggggaga actcaaccga      2640
     tttatcgaaa attctcttca acaaagccat tttgtccccc gctgtaaaac ctgcggaaaa      2700
     ccactcgcac cgaatgctga attttcgatt tgtcaaagct gttttaataa cctgaaccgt      2760
     tccaaagctc aacaagcacg ctctaatcct gcagagaaaa agtactcttc aaagcgccgt      2820
     tag                                                                    2823
//

If you have problems or comments...

PBIL Back to PBIL home page