(data stored in ACNUC7421 zone)

EMBL: CP002355.PE66

CP002355.PE66        Location/Qualifiers
FT   CDS_pept        complement(67262..68266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0066"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG2206 HD-GYP domain; InterPro IPR006674:
FT                   IPR003607; KEGG: ant:Arnit_2276 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region; SPTR: HD-GYP domain; PFAM: HD domain; TIGRFAM:
FT                   uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32734"
FT                   /db_xref="GOA:E4TWB8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB8"
FT                   /protein_id="ADR32734.1"
FT                   /translation="MDVRKVRIVRRHDERPNIMYVEIEKWLLDIGDVLEFDLFMAEGKL
FT                   TEKTLLLSKHIPINSDIKIEIDSRHAIYVRQSDLEAYNIFVDKIAQAVARNEHIPVIKK
FT                   AAIIYRQASVILDEMFENPEELENVPKTKKVVNTFVNTIFSDTHAIESMIKITAYDYYT
FT                   HTHSINVCIYSLSLGSYLELNSITLQELGMSALLHDLGKSRVDPKITNKKGRLTEDEFD
FT                   EMKHHPLYGHTIALKIGIRDNRILDGIRHHHEKLDGSGYPDGLMGNSITLFARIIAVCD
FT                   VFDALSTQRSYKERMSSYDTLLLMKKTMQHHLDMVLVDSFIKMQQHSDALTAL"
     atggacgtca gaaaagtacg cattgttcga cggcatgatg aaagaccaaa tatcatgtac        60
     gtagagattg aaaaatggct tttggacatc ggtgacgtac tggagtttga tctcttcatg       120
     gcagagggaa aactcacgga aaaaacctta ttgttgtcaa agcacatccc tatcaattcg       180
     gatataaaaa tagaaattga tagccggcat gcaatctatg ttcgtcaatc cgatcttgag       240
     gcatacaata tttttgtcga taaaatcgcg caggcggttg cacgaaacga acatattcct       300
     gttataaaaa aagcagccat aatttatcgt caggcatcgg ttattttgga cgaaatgttt       360
     gaaaatcccg aagagcttga aaatgtccct aaaaccaaaa aagtagtcaa tacattcgtc       420
     aatacgattt tcagcgatac gcatgcaatc gaatcgatga ttaaaattac cgcgtacgat       480
     tactataccc atacccattc gattaacgtt tgcatctatt ctctgagtct tggatcgtat       540
     ttggaactaa attccataac ccttcaggaa cttgggatgt cagccttgct tcatgatttg       600
     ggaaaaagca gagtcgatcc gaaaataacg aacaaaaaag ggcggttgac tgaggatgaa       660
     tttgatgaaa tgaaacatca tcctctctat ggccatacaa tcgctttaaa aataggaatt       720
     cgcgataatc ggattttaga cgggattcgc caccatcatg aaaaacttga cgggagcggc       780
     tatcccgacg ggcttatggg aaacagcata acgctttttg cccgtattat tgcagtctgt       840
     gatgtatttg acgccctttc tacacaacgt tcctataaag agaggatgag ttcctacgat       900
     acgctgctgt taatgaaaaa aacgatgcag catcatctgg atatggtgct ggttgactca       960
     tttatcaaaa tgcagcagca tagtgatgct ctaacggcgc tttga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page