(data stored in ACNUC7421 zone)

EMBL: CP002355.PE67

CP002355.PE67        Location/Qualifiers
FT   CDS_pept        complement(68273..68896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0067"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0040 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32735"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWB9"
FT                   /protein_id="ADR32735.1"
FT                   /translation="MKKMTIADAAEYFNVSKEAIHNRIRRGSLDCIVDNGVKYVAVESA
FT                   KSGTSTTVASDARYTQYIEQENERLREKVDVLEKETNRLRDQREQMLIDERIKVEQIYK
FT                   ERDAQLRSVLHVVATKFLAHASVDAVMEEAKGVDAINADVVEGNEEEWVSLKSFLKLKR
FT                   YSDKEKKKIKNRFEALRENDIRLTVREGKIFLNPSEYDYSDLLR"
     atgaaaaaaa tgacaattgc cgatgcggcg gaatatttca acgtttctaa agaagcgatc        60
     cacaaccgta tacgccgcgg aagtttggat tgtattgtgg acaacggggt taaatatgtt       120
     gctgtcgaat cggcgaagag cggcacttca acaacagttg cgagtgatgc acgatatact       180
     cagtatattg agcaggagaa tgaacggctc cgtgaaaaag tagatgttct tgagaaagag       240
     accaatcgct tacgggatca gcgggagcaa atgctaattg atgagcggat taaagtcgag       300
     cagatataca aagagcggga tgcccagtta cgcagcgttt tgcatgttgt agcgacaaaa       360
     ttccttgccc atgcttccgt tgatgccgtt atggaagaag cgaaaggtgt agatgccatt       420
     aatgccgatg ttgtagaggg gaatgaagaa gagtgggttt cgctcaaatc ttttttaaag       480
     ctcaaacgct acagcgataa agagaagaaa aaaataaaaa accggtttga agcattgagg       540
     gaaaatgaca tacggctcac tgtacgtgag gggaaaattt ttttaaaccc ttccgaatac       600
     gattattcgg atttgctgcg ttag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page