(data stored in ACNUC7421 zone)

EMBL: CP002355.PE68

CP002355.PE68        Location/Qualifiers
FT   CDS_pept        complement(68893..69846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0068"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COGs: COG2206 HD-GYP domain; InterPro IPR006674:
FT                   IPR003607; KEGG: ant:Arnit_2276 metal dependent
FT                   phosphohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region; SPTR: HD-GYP domain; PFAM: HD domain; TIGRFAM:
FT                   uncharacterized domain HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32736"
FT                   /db_xref="GOA:E4TWC0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWC0"
FT                   /protein_id="ADR32736.1"
FT                   /translation="MKQKKYKRIDKRLITEGSQIDFNLFLTNETKTHMTLFLQSDSAVD
FT                   GNAKVRLREIETLYISEEEEDRYKVFVDKQLQSIARNREISTEQKARLVYEKATEAIDS
FT                   MFKNPESLENVKNVQPVVNSFIEIILNDSSAVESLMKITAHDYYTHTHSINVSIYTLSL
FT                   GAFLGISGKELEVLGMAAVLHDLGKSKVDYEIINKNGKLTDEEFAQMKHHPSLGHEIAL
FT                   ALGITDERILTGIRHHHEKIEGGGYPDNLKGDQISQFARIIGTCDVFDALSTKRSYKDP
FT                   MTSFESLQLMKQQMVGHLDMDIVNSFIKMLHKQGKS"
     atgaagcaaa aaaagtacaa gcgaatcgat aaacggctga ttaccgaagg atcgcaaatc        60
     gactttaatc tttttttgac caatgaaaca aaaactcata tgaccctttt tttacaaagc       120
     gacagtgcgg tagacggaaa tgcaaaagta cggcttcgcg aaatcgaaac actgtatatc       180
     tccgaagaag aagaggaccg atacaaagta tttgtcgata agcagctcca aagtattgca       240
     cgaaacaggg aaatttcgac agaacaaaaa gctcgattgg tttatgaaaa agcgaccgaa       300
     gcgatagatt cgatgtttaa aaatcccgaa tcgctggaga atgttaaaaa cgttcaaccg       360
     gttgtcaaca gctttatcga aatcatactg aatgacagca gtgccgttga atcgttgatg       420
     aagattacgg cacatgatta ctatacccat acccattcca ttaacgtcag tatctatacg       480
     cttagtctcg gtgcattttt ggggatcagc ggaaaagagt tggaagtgct gggaatggcg       540
     gcagttttgc acgatttagg gaaaagtaaa gtggattatg agattatcaa caaaaacggt       600
     aaactcaccg atgaggagtt cgctcaaatg aaacatcatc cgtcgctcgg tcatgagatt       660
     gcattggctc tgggtatcac ggatgaacgt attttgaccg gtatccgtca tcatcatgaa       720
     aagatcgagg gaggcggcta tcccgataac cttaaaggag atcagatcag ccaatttgcc       780
     cgaataatcg gtacgtgtga tgtttttgac gccctatcga ccaagcgctc gtacaaagat       840
     ccgatgacct cttttgaatc attgcaattg atgaaacaac agatggtagg tcatttggat       900
     atggatatcg tgaattcatt tatcaaaatg ttacacaagc aaggaaaatc atga             954
//

If you have problems or comments...

PBIL Back to PBIL home page