(data stored in ACNUC7421 zone)

EMBL: CP002355.PE70

CP002355.PE70        Location/Qualifiers
FT   CDS_pept        complement(70408..71109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0070"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG0479 Succinate dehydrogenase/fumarate
FT                   reductase Fe-S protein subunit; InterProIPR006058:
FT                   IPR017900: IPR004489: IPR001041: IPR 017896; KEGG:
FT                   tdn:Suden_0038 succinate dehydrogenase/fumarate reductase
FT                   iron-sulfur protein; PFAM: ferredoxin; SPTR: Fumarate
FT                   reductase iron-sulfur protein; TIGRFAM: succinate
FT                   dehydrogenase and fumarate reductase iron-sulfur protein;
FT                   PFAM: 2Fe-2S iron-sulfur cluster binding domain; TIGRFAM:
FT                   succinate dehydrogenase and fumarate reductase iron-sulfur
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32738"
FT                   /db_xref="GOA:E4TWQ7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWQ7"
FT                   /protein_id="ADR32738.1"
FT                   /translation="MNISIKRSNNDEVQIYNVELENTTLLAVLNYIKTKIDPTLTYSHG
FT                   CRSGVCGSCAVRVNGREQLMCEYKPKDGDVIEPIRNTRVIRDLVVDTAFVERFNQAGEA
FT                   WIGSAREENISVEEMERIETQSDCILCTSCFSACPVYAVNPDFIGPFALTRVWRYVNDP
FT                   REGDSSAKIAAVQTNGIWDCTLCGECVPVCPQGIAPKQDISMLRTKSAMAGYSDPNMSF
FT                   GGGLDFGSPMF"
     atgaatattt cgataaagcg ttcaaataac gatgaagttc aaatctataa cgtcgagtta        60
     gaaaatacca cgcttcttgc ggttttgaac tatattaaaa ccaaaatcga tccaacattg       120
     acctattctc acggatgccg cagcggcgta tgcggaagct gtgccgtacg ggtaaacgga       180
     cgtgagcaac tgatgtgcga gtataaacca aaggacggag acgtaattga gccgatacga       240
     aatacccgtg tcatccgtga tctggttgtg gataccgcgt ttgtagaacg ttttaaccag       300
     gcaggagaag catggatcgg atctgcgaga gaagagaata taagcgttga agagatggag       360
     cggattgaga cgcaaagcga ctgtattctc tgtacgtcgt gttttagtgc ctgccccgta       420
     tatgccgtga accccgactt catagggccg tttgccctaa cacgggtatg gcgttatgtg       480
     aacgatccgc gcgaggggga tagcagtgca aaaatcgcag ccgtccaaac caacggcatc       540
     tgggactgta ctctctgcgg cgagtgtgtc ccggtgtgtc cgcaggggat cgctccgaaa       600
     caggatattt cgatgctgcg aaccaaaagt gcgatggcgg gatattccga tccgaatatg       660
     agttttggcg gaggattgga ttttggttca ccgatgtttt ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page