(data stored in ACNUC7421 zone)

EMBL: CP002355.PE71

CP002355.PE71        Location/Qualifiers
FT   CDS_pept        complement(71109..71264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pvx:PVX_081400 patched family protein; SPTR:
FT                   Patched family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32739"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWQ8"
FT                   /protein_id="ADR32739.1"
FT                   /translation="MRGFYTMNEDISVLGDDKTWNDEKESDWNGRCEDVSEEDDDEEDE
FT                   EREWCD"
     atgcgcggat tttatacaat gaatgaagat atttctgtgt taggcgatga taaaacatgg        60
     aatgatgaaa aagagagcga ctggaacggc cgatgcgaag atgtcagcga ggaagacgat       120
     gacgaagaag atgaagaaag agagtggtgt gattga                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page