(data stored in ACNUC7421 zone)

EMBL: CP002355.PE72

CP002355.PE72        Location/Qualifiers
FT   CDS_pept        complement(71243..72844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0072"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="COGs: COG1053 Succinate dehydrogenase/fumarate
FT                   reductase flavoprotein subunit; InterPro IPR013027:
FT                   IPR003953: IPR004112; KEGG: nis:NIS_0006 succinate
FT                   dehydrogenase/fumarate reductase, flavoprotein subunit;
FT                   PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; PRIAM: L-aspartate oxidase;
FT                   SPTR: Succinate dehydrogenase flavoprotein subunit; PFAM:
FT                   domain; FAD binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32740"
FT                   /db_xref="GOA:E4TWQ9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWQ9"
FT                   /protein_id="ADR32740.1"
FT                   /translation="MSKVLIVGSGGAGLVSALSATESGAKVIVASKTLPTRSQTSMAQG
FT                   GMNAVFGSEDSIENHIADTLRSSAGLGEEGRIALMCEKAPEAVRWCNTIGLPFSRDEKG
FT                   EIARRTLGGASAPRACYAQDYTGLKLLHTLYDQCLKAGIEFRNDRFLLNLIVDQETNRA
FT                   LGATFLHIETGEVEEIRADAVILATGGYGALYGKHSTNSVQATGDGLAAAVRAGARLAD
FT                   MEFIQFHPTALKNSSILISESARGAGGYLVDSEGERFTDELAPRDVVARAIHDEMAKSG
FT                   AVYLDIRHLGEDFINHELPQERKLAQIYEGIDPVHELIPIKPSAHYSMGGIEVNEKCMT
FT                   SVSALFAVGECANHKTHGANRLGGNSLLELVVFGRECGKNAAEYGALHPAPVLENMQLA
FT                   KDTNFVRGVMYFTNQIDFYQKQEMLANIFYNNVGLVRDDMGLKAVLGAIRQMQKELPFM
FT                   GPRDKSKVCNTNLVEFIEFGNKIELAEIIVVSAISRVESRGAHYRLDAPERNDRMFGAH
FT                   TITWKEDGVLCADFIQ"
     atgtcaaaag tattgatcgt cggcagcggc ggagcaggct tggtaagcgc tctttccgca        60
     acagaaagcg gagcaaaggt aattgtcgct tcgaaaacac tccctaccag atcgcaaacc       120
     tctatggcac agggggggat gaatgcggta tttggctctg aggattcgat tgaaaaccat       180
     atcgccgata cccttcgttc ttctgcaggc ttgggggaag aagggcggat cgcattgatg       240
     tgcgagaagg ctcccgaagc ggttcgctgg tgcaacacaa taggtttgcc gtttagccgt       300
     gatgaaaaag gggagatcgc tcgtcgcact ttaggcggtg catcggctcc gcgggcttgt       360
     tatgcgcaag actatacggg attgaaactc ctccacaccc tttatgatca atgtctcaaa       420
     gcgggaatcg aatttagaaa tgaccgcttt ttattgaacc tcatcgtaga tcaggagact       480
     aaccgggcgt taggggcaac gtttttgcat atcgaaacgg gcgaggtcga agagattcgt       540
     gccgacgccg ttattctcgc gacgggagga tatggtgcgt tatacggcaa acactcgact       600
     aattcggttc aagcgacggg tgatgggctg gcggcggctg tacgtgccgg agctcgtttg       660
     gccgatatgg aatttattca gttccatcct accgctctta aaaactcttc tattttgatt       720
     tctgagagtg ctcggggcgc ggggggatat ttggtggatt cggaagggga gcgttttacc       780
     gatgaactgg caccgcgcga tgtcgtagca cgcgctatcc atgatgagat ggctaaaagc       840
     ggagccgtct atctcgatat tcgccatctc ggggaggatt ttattaatca tgaacttcct       900
     caagaacgaa agctggcaca gatttatgag gggatcgatc cggtacacga actgatcccg       960
     atcaaaccgt ctgcccatta cagcatgggg gggatcgagg tcaatgagaa gtgtatgaca      1020
     agcgtaagcg ctctgtttgc cgtcggcgaa tgtgccaatc ataaaacaca cggagcgaac      1080
     cgtttgggag ggaactcttt attggaactc gttgtttttg gacgcgaatg tggcaagaat      1140
     gcggctgagt acggggctct tcaccccgct cctgttttgg aaaatatgca gttagcgaaa      1200
     gataccaact tcgtccgagg tgtcatgtat tttacaaacc agatcgactt ttaccaaaag      1260
     caggaaatgc tcgctaacat cttctataac aacgtcggac tcgtacggga tgatatgggg      1320
     cttaaagcgg tgctcggagc gatccggcag atgcaaaaag aactcccgtt tatgggaccg      1380
     cgggacaagt cgaaagtctg caatactaat ttggtcgaat ttatcgaatt cggaaacaaa      1440
     atcgaattgg cggagattat cgtcgtcagt gcgatcagcc gtgtcgagag ccggggagcg      1500
     cattatcgac tcgacgcgcc ggaacgcaac gaccggatgt tcggggctca tacaatcaca      1560
     tggaaagagg atggagtgct atgcgcggat tttatacaat ga                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page