(data stored in ACNUC7421 zone)

EMBL: CP002355.PE73

CP002355.PE73        Location/Qualifiers
FT   CDS_pept        complement(73010..73267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0073"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR005829; KEGG: mbr:MONBRDRAFT_34030
FT                   hypothetical protein; SPTR: Predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32741"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR0"
FT                   /protein_id="ADR32741.1"
FT                   /translation="MKKFFCVLLLVGFIGASANDALKAEVAAWLQGLDGGAQKAKYDSL
FT                   SPEKQAALDKFFEECRADVASGKSPKGTCKPLFLEKLKAL"
     atgaaaaagt ttttttgtgt tttgttattg gtcggtttta ttggagcatc tgcaaatgat        60
     gctttaaaag cagaagttgc ggcatggctt cagggcttag atgggggtgc gcaaaaggca       120
     aagtatgact ctctttctcc tgagaaacaa gctgctttgg ataaattttt tgaagagtgc       180
     agagcagatg tagctagcgg aaaatcgcca aaagggacgt gcaaacctct ttttttggaa       240
     aagctaaaag cactttag                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page