(data stored in ACNUC7421 zone)

EMBL: CP002355.PE74

CP002355.PE74        Location/Qualifiers
FT   CDS_pept        73396..74301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0074"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="COGs: COG0679 permease; InterPro IPR004776; KEGG:
FT                   tdn:Suden_0341 auxin efflux carrier; PFAM: Auxin Efflux
FT                   Carrier; SPTR: Auxin Efflux Carrier; PFAM: Membrane
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32742"
FT                   /db_xref="GOA:E4TWR1"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR1"
FT                   /protein_id="ADR32742.1"
FT                   /translation="MQTLFSILGIYLFIAVGFGAKWAFKEKIDDRTITLLSVYFLQIFL
FT                   TFWGLLKRPIDTELLFAPSLYLAITLLALLLMIPLAKMLFHNPKERSIATVAALIGNTG
FT                   NLGIPLGIALFGEMSVPFLTLINLVNVFVVYTIGVFYYSRGEFSVRDSLLNILKLPVLW
FT                   AAMIAIALNLVGYVPSPAVDKTLMMGAYASMTMQLVLFGIYLYGIKLGEINLRLTAWVN
FT                   GTKFILIPLIAFGVLHYVDMEPVVKGILFLELIVPLAVANVNLASLYHCSPRTVTVEVF
FT                   TTSVVFLGIALILPTLLRMF"
     atgcaaactt tattttccat tctgggcatc tacctcttta ttgctgtcgg attcggtgcc        60
     aaatgggcgt tcaaagagaa aatcgacgac cgcaccatca ccttgctcag tgtctatttt       120
     ttacagattt ttctcacctt ttggggactt ctcaaacgtc cgatcgatac ggaactcctc       180
     tttgccccct ctttgtatct ggcaattacc cttttggctc tgctgttaat gattcctctg       240
     gctaaaatgc tttttcataa tccaaaagag cgttccatcg ctaccgtagc ggcattgatc       300
     ggcaatacgg ggaatctcgg cattccgctg ggaatagcac ttttcggtga gatgagcgtc       360
     ccgtttctta cccttatcaa tctcgtcaac gtatttgtcg tctacactat cggggtgttt       420
     tattattcgc gcggagaatt cagcgtccgc gattcgctgc tcaatatcct caaacttccc       480
     gttctttggg ctgccatgat cgccattgcc ctcaatctcg tcggatatgt cccaagcccg       540
     gccgtcgata aaacgctgat gatgggagcg tatgcctcga tgacgatgca gcttgtattg       600
     ttcggtatct atctgtacgg gatcaaattg ggagagatca atctccgtct cacggcgtgg       660
     gtaaacggta caaaatttat cctgataccg ttaatcgctt ttggtgtact gcactatgtt       720
     gatatggagc cggtggtcaa agggattttg tttttggaat tgattgtccc gctggccgtc       780
     gccaatgtta atttggcttc actctatcat tgttctcccc gcaccgttac ggtggaggtg       840
     tttacaacgt cagtcgtatt tttggggatt gcgctgatat tgcctacgct tttacgaatg       900
     ttttga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page