(data stored in ACNUC7421 zone)

EMBL: CP002355.PE75

CP002355.PE75        Location/Qualifiers
FT   CDS_pept        complement(74279..75208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0075"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="COGs: COG1052 Lactate dehydrogenase and related
FT                   dehydrogenase; InterPro IPR006140: IPR006139; KEGG:
FT                   tdn:Suden_0034 2-hydroxyacid dehydrogenase; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase NAD-binding; D-isomer
FT                   specific 2-hydroxyacid dehydrogenase catalytic region;
FT                   SPTR: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding; PFAM: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD binding domain; D-isomer specific
FT                   2-hydroxyacid dehydrogenase, catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32743"
FT                   /db_xref="GOA:E4TWR2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR2"
FT                   /protein_id="ADR32743.1"
FT                   /translation="MKIVILDALTYSDTSLEGFESLGDVAVYQTTFSDETTERVCDAEV
FT                   IVTNKVVINDAVMESAPNLKLICVAATGTNNIDHEAAKRRGIAVKNVAGYSTDAVVQHT
FT                   FSMLFYLMGHSRYYDEYVKSGAWQREAVFAHIGPSFSELRGKTWGIIGLGEIGRGVARV
FT                   AQAFGANVCYYSTSGKNDNGEYEKTTLSRLIENSDVISIHAPLNASTENLISHSELLQM
FT                   KDGAVLLNLGRGGIVDEDALSVIIDVKPIFVGLDVLAKEPMKTSHPLLSVKHPERLYIT
FT                   PHIAWTSREARERLIASTIENIKTFVKA"
     atgaaaatag taatccttga tgcactaacg tatagtgata cctcgttaga gggttttgaa        60
     tctctgggcg atgtggctgt ttatcagacg acattttccg atgagacgac ggagcgtgtt       120
     tgcgatgcgg aggtgatcgt gacaaacaag gtagtgatta acgatgccgt gatggaaagt       180
     gctccgaacc taaaactcat ctgtgtggcg gcgacgggga caaataatat cgatcatgaa       240
     gctgccaaac ggcggggaat agcagttaaa aacgttgcgg gatattcgac cgatgcggtc       300
     gtgcagcata cgttttcaat gcttttttat ctgatggggc attctcgtta ttatgatgaa       360
     tacgtaaaaa gcggcgcatg gcagcgcgaa gcggtatttg cccatattgg gccctcattt       420
     agcgaactgc gcggtaaaac gtgggggatt atcggattgg gcgaaatagg gcgcggcgtg       480
     gcgcgtgtag ctcaggcatt cggtgctaac gtctgttatt attcaacgtc gggcaaaaac       540
     gataacggcg agtatgaaaa aacgaccctc agccgtttga tcgagaacag tgatgtgatt       600
     tcgatccatg cgccgctcaa tgcctcgacg gagaatctga tttcccattc ggaactgttg       660
     cagatgaaag acggtgccgt gctcctcaat ctcggacgcg gcggtatcgt cgatgaagat       720
     gccctgtcgg ttatcatcga tgtgaaaccg atcttcgtcg gattggatgt attggcgaaa       780
     gagccgatga aaacatcaca tcctctttta tctgtcaaac atcctgaacg gctctatatt       840
     actcctcata tcgcatggac atcgcgcgaa gcacgagaac gtcttatcgc ctcgacgatc       900
     gaaaatatca aaacattcgt aaaagcgtag                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page