(data stored in ACNUC7421 zone)

EMBL: CP002355.PE76

CP002355.PE76        Location/Qualifiers
FT   CDS_pept        complement(75343..76506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0076"
FT                   /product="formate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number="6.3.4.-"
FT                   /note="COGs: COG0027 Formate-dependent
FT                   phosphoribosylglycinamide formyltransferase (GAR
FT                   transformylase); InterPro IPR005862: IPR011761: IPR003135;
FT                   KEGG: tdn:Suden_0033 phosphoribosylglycinamide
FT                   formyltransferase 2; PFAM: ATP-dependent carboxylate-amine
FT                   ligase domain protein ATP-grasp; SPTR:
FT                   Phosphoribosylglycinamide formyltransferase 2; TIGRFAM:
FT                   phosphoribosylglycinamide formyltransferase 2; PFAM:
FT                   ATP-grasp domain; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32744"
FT                   /db_xref="GOA:E4TWR3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR3"
FT                   /protein_id="ADR32744.1"
FT                   /translation="MLFSAPLKNNSKKIMLLGSGELGKEVAIEAQRLGIEVIAVDRYNH
FT                   APAHLVANRSHVVNMQDKEAVLKLIRKEKPDYILPEIEAISIDALFAAEAEGFCVIPNA
FT                   EAVNKTMNRKNIRRFAAEDLGLKTSRYHFVSTYEDMCASAEDVGFPCVIKPVMSSSGHG
FT                   QSIARTREDLAASWEIAKEARGDASELIVEEFIRFDYEITLLTARNGVETVFCEPIGHI
FT                   QKDGDYIYSWQPMEMSKKALKRSQKIAKAITDGLGGKGLFGVELFVAGDEVYFSEVSPR
FT                   PHDTGMVTLITQSQSEFALHVRAVLGLPLGFTFYGDGASAAFKSVVESTEPVVDVADEV
FT                   FDDNSFVRVFGKPEAHVGRRMAVVLVFDKVNKAMKKAKKLIKKIKDA"
     atgctcttta gcgcacctct taaaaataat tccaaaaaaa tcatgttgtt aggctccggc        60
     gaactcggta aagaagtggc aatagaagca cagcgtctgg gaatcgaggt cattgcggtc       120
     gaccgttaca atcatgcacc tgctcatctc gttgccaatc gctctcatgt ggtgaacatg       180
     caggataaag aagcggtatt aaagcttatc cgcaaagaga aacccgacta tattctccct       240
     gagatcgaag cgatcagtat cgatgcgttg ttcgccgccg aagcggaagg attttgcgtt       300
     atcccgaatg ccgaagcggt gaataaaaca atgaaccgaa aaaatatccg ccgttttgcc       360
     gccgaagatc tcgggctaaa aacaagccgt tatcattttg tgagtaccta tgaggatatg       420
     tgcgcttcgg cggaagatgt cgggttcccg tgtgttatca aaccggtgat gagttcttcg       480
     gggcatgggc aaagtatcgc tagaacgcgt gaggatttag ccgcgtcatg ggagattgcc       540
     aaagaagctc gcggcgatgc aagcgagcta atcgttgaag agtttatccg ttttgattac       600
     gaaatcacac ttctgacggc acgtaacgga gtggagacgg tattttgcga accgatcggt       660
     catatccaaa aagacggcga ttacatctac agttggcagc cgatggagat gtccaaaaaa       720
     gcgctcaaac gctctcaaaa aatagcgaaa gcgattaccg acggattggg cggcaaaggg       780
     cttttcggtg ttgagctgtt tgtggcggga gatgaggttt atttcagcga agtgagcccg       840
     cgtccgcatg acacagggat ggtaacattg atcacccaaa gccaaagcga atttgcactg       900
     catgtacgcg cagtgcttgg attgccgctc ggatttacct tttacggtga cggtgcgagt       960
     gcggcgttta aatcggtagt cgagtcgaca gaaccggttg tcgatgtggc cgatgaagtg      1020
     tttgatgata acagtttcgt ccgtgtattc ggaaaacctg aagcacatgt cgggcgacgg      1080
     atggcggttg tactcgtatt tgacaaagta aataaagcga tgaaaaaagc gaaaaaattg      1140
     attaagaaga ttaaagacgc ttaa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page