(data stored in ACNUC7421 zone)

EMBL: CP002355.PE78

CP002355.PE78        Location/Qualifiers
FT   CDS_pept        76950..78614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0078"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004089; KEGG: cco:CCC13826_1039 protease HtpX;
FT                   PFAM: chemotaxis sensory transducer; SMART: chemotaxis
FT                   sensory transducer; SPTR: Methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: Methyl-accepting chemotaxis
FT                   protein (MCP) signaling domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32746"
FT                   /db_xref="GOA:E4TWR5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR5"
FT                   /protein_id="ADR32746.1"
FT                   /translation="MHPRKTLMWLVFIGMMIPPVVWILLLAFSHLFSVDELISILFSIP
FT                   MALYMAVATSAMIFGFNHALIRIETLMKNPNRSEEAAAIVSKLPYWFLIGQLLYTSIGP
FT                   AVVLSGKSFISLERFGLAEAAVLPLLLLFIIPVFILFVIRLEEWVVSVPLSEKYPFVSF
FT                   GRKMVLAIFTTVLGNIILLVLLNTILLYSIPGLDLSTLLIKNSIVAVIGIVISAVNIAL
FT                   LVAQVTRPVKNLTDNLKTDLFNLTKSFSGFTRDETGSMMSCLNRFVGEIEHSISHAKEI
FT                   ASANLSSAQTLDTINTHIKSRVHESNSITQTTSDQAHSIQTIVNEGVENFTVTLENMNN
FT                   AVGLLHHGRQELSTLLDTISHSTELETELSSKLDQLNGEASQVQKILSVIGDIAEQTNL
FT                   LALNAAIEAARAGEHGRGFAVVSDEVRKLAERTQKSLTEINATINVIVQSIADATEQMH
FT                   LNAKAMQNLTMISQRVDKDINETVSAMENTNMLTKQSVTNSQTIANHINSMLVQMEKLG
FT                   TISSANDTSMRELSDIVSQIASSANALYTQLGQFKTH"
     atgcatcccc gaaaaacatt gatgtggctg gtttttatcg gtatgatgat acctcctgtc        60
     gtatggattt tattattggc attttcacat ctgtttagtg tggacgaatt gatttcaatc       120
     cttttttcaa ttcctatggc tctttatatg gcggttgcga caagcgccat gattttcgga       180
     ttcaaccatg cccttatacg gatcgaaacc cttatgaaaa atccgaacag gagtgaggaa       240
     gccgccgcaa tcgtttccaa actcccgtat tggtttttaa tcggccagct tctttatacg       300
     tcgatagggc ctgcagtagt tctaagcggg aaatcgttta tttcccttga gcggttcggc       360
     cttgcggaag ccgccgtcct tccgctgctg ctgttattta tcatcccggt ttttatttta       420
     ttcgttatcc gtctcgaaga gtgggtagtt agcgttccgc tgagtgaaaa atatcctttt       480
     gtctctttcg gaagaaaaat ggttctggcc atatttacaa ccgttttggg aaatattatt       540
     ttgctcgtct tgctcaatac gattttgctc tattcgatac cggggctcga tttatctacc       600
     cttttaatta aaaacagtat tgtcgccgtg ataggaatcg tcatctccgc tgtcaatatc       660
     gctcttttgg tagcacaggt cacccgcccg gtaaaaaatc tgaccgacaa tctcaaaact       720
     gatctattta atctgacaaa atcgtttagc ggatttaccc gtgacgaaac gggaagcatg       780
     atgagctgct taaaccgctt cgtgggagaa attgagcatt ccatctctca tgcgaaagag       840
     attgcatccg caaatttaag ctctgcgcaa acacttgata ctatcaatac ccatattaaa       900
     agccgtgttc atgagagcaa ttccatcacg cagacgacat cggatcaggc ccactcaatc       960
     caaacgatcg tcaatgaagg ggtagaaaat ttcacggtga ctctggaaaa tatgaacaat      1020
     gccgtcggac tgctgcacca cggacggcag gaactatcca cccttttgga taccatttct      1080
     cacagtacag agcttgaaac agaactcagc agcaaactcg atcaactaaa cggggaggcc      1140
     tctcaagtcc aaaaaatcct ctccgtcatc ggcgatattg ccgagcaaac caatcttctc      1200
     gcactcaacg ccgcgatcga agcggcacgt gcgggagaac acggaagagg gttcgccgtc      1260
     gtctctgatg aggtgcgaaa actggccgaa cggacgcaaa aaagtttgac cgaaatcaat      1320
     gctacgatta atgttattgt ccagagcatt gccgacgcaa ccgaacagat gcatctaaac      1380
     gccaaagcga tgcaaaacct cactatgatc tcacagaggg tggataaaga tataaatgaa      1440
     accgtcagtg cgatggaaaa taccaacatg ctgacaaaac aaagcgttac aaattcccaa      1500
     accattgcaa accacatcaa ctccatgctg gttcaaatgg aaaaactcgg gaccatttca      1560
     tcggctaacg atacctccat gcgagaactc tccgatatcg tttcccaaat cgcctcgtcg      1620
     gctaatgcac tttatacgca gttagggcaa tttaagacac attaa                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page