(data stored in ACNUC7421 zone)

EMBL: CP002355.PE8

CP002355.PE8         Location/Qualifiers
FT   CDS_pept        complement(8677..9528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0008"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family"
FT                   /note="COGs: COG0573 ABC-type phosphate transport system
FT                   permease component; InterPro IPR011864: IPR000515; KEGG:
FT                   tdn:Suden_1885 phosphate ABC transporter permease; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; SPTR: Phosphate ABC transporter, permease
FT                   protein PstC; TIGRFAM: phosphate ABC transporter, inner
FT                   membrane subunit PstC; PFAM: Binding-protein-dependent
FT                   transport system inner membrane component; TIGRFAM:
FT                   phosphate ABC transporter, permease protein PstC; phosphate
FT                   ABC transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32676"
FT                   /db_xref="GOA:E4TW60"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW60"
FT                   /protein_id="ADR32676.1"
FT                   /translation="MIDKIFLNMTRTSALLILFIVAWIFVVLFNHSTEAMQTFGFDFIT
FT                   KDEWAPNLDKFGAYAAIFGSVASTFLAMLLAIPVAIGVAIFLSEIAHDKIKGFFGVSVE
FT                   LLAAIPSVIYGMWGLFFFVPILRDIFGGMGIGLLAAGIVLAIMILPFMAAVTRDAMNTT
FT                   PDILKESAYALGGTQWDVIKDVIIPYAKAGIIGSLILALGRAIGETMAVTFVMGNVHHT
FT                   PSSIMDPTTSIPVTLANEFTEADSSLYFSSLFGLALTLLIMSFVVIAIAKFYFLRKVRK
FT                   GQ"
     atgattgata aaatcttctt aaacatgacc cgcaccagcg cactgctgat tttattcatc        60
     gtcgcatgga tatttgtggt cctctttaat cactccaccg aagcgatgca gaccttcggc       120
     tttgatttca tcaccaaaga cgaatgggcg ccgaatctcg ataaattcgg tgcctatgcg       180
     gctatattcg gctcggtcgc ttctactttt ttggcaatgc ttttggctat cccggttgcg       240
     atcggcgtcg ccatctttct gagcgaaatc gcccatgaca aaatcaaagg attcttcggc       300
     gtaagcgttg agctccttgc cgctatcccc tcggtcattt acgggatgtg gggattgttt       360
     ttcttcgtcc ctatcttacg cgatattttc ggcggaatgg ggattggtct gcttgcagcg       420
     ggaattgttt tggccattat gattcttccg tttatggctg ccgttacccg cgatgcgatg       480
     aatacgacac ccgatattct caaagaatcc gcttatgcac tcggcgggac acaatgggat       540
     gtcattaaag acgtcatcat cccttacgca aaagcaggta ttatcggttc tcttatcctg       600
     gcactcggcc gagcgatcgg tgagacaatg gcggttacgt tcgttatggg gaatgtccat       660
     cacaccccga gctcaattat ggatccgacg acttcgattc cggttaccct tgccaatgag       720
     tttaccgaag ccgacagttc cctttatttc tctagcctat tcggattagc attgacattg       780
     ctcattatga gctttgtcgt tattgccatc gcaaaatttt attttttgcg taaagtgagg       840
     aaaggacaat ga                                                           852
//

If you have problems or comments...

PBIL Back to PBIL home page