(data stored in ACNUC7421 zone)

EMBL: CP002355.PE80

CP002355.PE80        Location/Qualifiers
FT   CDS_pept        80435..81406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0080"
FT                   /product="Queuosine synthesis"
FT                   /note="COGs: COG0482
FT                   tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
FT                   contains the PP-loop ATPase domain; InterPro IPR018317;
FT                   KEGG: tdn:Suden_0026 thiamine biosynthesis protein:ExsB;
FT                   PFAM: Queuosine synthesis-like; SPTR: Thiamine biosynthesis
FT                   protein:ExsB; PFAM: Thiamine biosynthesis protein (ThiI)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32748"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR7"
FT                   /protein_id="ADR32748.1"
FT                   /translation="MKAIALFSGGLDSTLAAKLIIDQGIEVIACNINTGFGSTKDRLAH
FT                   MKNMCEQIGAEFRSVDIRDEYIREVLFTPKYGYGKNFNPCIDCHAKMFEVAKRVMEEWG
FT                   ASFLISGEVLGQRPMSQNSESLQKVLNLSNCEGLLLRPLSAKALTPTIPETEGWVDREK
FT                   LENINGRNRERQMELAEQFGLKDYEAPGGGCLLTDENFSNKIRDFIAHDTFSVEDIPTL
FT                   KYGRQLRLPEGAKLIIGRNAEDNAVLEAIENSKFIHIRTELVGPHAMLSRTATDNDKTL
FT                   AAKLVLAYCKAGFEGEQTLMFGDEELTAVSDLSRNDAQKYFI"
     atgaaagcaa tcgctttatt cagcggcgga ctcgattcga cactcgcggc caaactcatt        60
     atcgatcagg gaatcgaggt gatcgcctgc aacatcaata cgggattcgg ttcgaccaaa       120
     gaccgtctgg cacacatgaa aaacatgtgt gaacagatcg gtgccgagtt tcgaagcgtc       180
     gatatccgtg acgaatacat ccgtgaagtt ctctttaccc cgaaatacgg ctacggtaaa       240
     aacttcaacc cctgcatcga ctgccatgcc aaaatgttcg aagtggccaa acgcgtcatg       300
     gaagagtggg gggctagctt tctaatcagc ggcgaagtgt tgggtcaacg tccgatgagc       360
     caaaacagcg aatctcttca aaaagtgctc aatctcagca actgtgaagg gctgctactc       420
     cgtcccctca gtgccaaagc actaacgccg actattcccg agaccgaagg atgggtggat       480
     cgtgaaaagc tcgaaaatat caacggacgc aaccgcgaac gccaaatgga actggcggaa       540
     cagttcggtc tcaaagatta tgaagcaccg ggcgggggat gcctccttac cgatgaaaac       600
     ttctccaata aaatccgtga ttttattgcc cacgatacct tcagcgttga agatatcccg       660
     accctcaaat acggtcgcca gcttcgtctt ccggaagggg caaaacttat catcgggcgt       720
     aatgcggagg ataacgccgt gttagaggca atcgaaaact ccaaattcat ccatatccgt       780
     accgaacttg taggccctca tgcgatgcta tcacgcactg caacggataa tgataaaacg       840
     ttagcggcaa aactggtgtt agcctattgc aaagcgggat tcgaggggga gcaaacgttg       900
     atgtttggag atgaagagct aaccgccgtt agcgacctaa gccgcaacga tgcgcagaag       960
     tattttatct aa                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page