(data stored in ACNUC7421 zone)

EMBL: CP002355.PE81

CP002355.PE81        Location/Qualifiers
FT   CDS_pept        complement(81525..81788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0081"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="InterPro IPR017969: IPR006121; KEGG: bam:Bamb_4827
FT                   heavy metal translocating P-type ATPase; PFAM: Heavy metal
FT                   transport/detoxification protein; SPTR: Cation transport
FT                   ATPase; PFAM: Heavy-metal-associated domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32749"
FT                   /db_xref="GOA:E4TWR8"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWR8"
FT                   /protein_id="ADR32749.1"
FT                   /translation="MKKVLLTLCALVAVASADQLVNLKIDGMMCPACVKNVKGSLADVK
FT                   GVKESTVYLKEGKAEVKAADSTKADSLCDAVKKAGYGCTVTK"
     atgaaaaaag ttcttctcac tttgtgtgca ttagtagcgg ttgctagtgc cgatcaactg        60
     gtcaatctta aaattgacgg aatgatgtgt cctgcttgtg ttaaaaatgt aaaaggctca       120
     ttggcggatg tcaaaggggt taaagaatcg actgtttatc ttaaagaggg aaaagccgaa       180
     gttaaagcgg ctgatagcac taaagccgat agcctgtgcg atgccgttaa aaaagcaggc       240
     tacggctgta cagtcactaa ataa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page