(data stored in ACNUC7421 zone)

EMBL: CP002355.PE83

CP002355.PE83        Location/Qualifiers
FT   CDS_pept        complement(82615..83406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0083"
FT                   /product="putative signal transduction protein"
FT                   /note="COGs: COG1639 signal transduction protein; InterPro
FT                   IPR013976; KEGG: sdl:Sdel_0866 metal-dependent hydrolase
FT                   HDOD; PFAM: Metal-dependent hydrolase HDOD; SPTR:
FT                   Thiamine-phosphate kinase; PFAM: HDOD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32751"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS0"
FT                   /protein_id="ADR32751.1"
FT                   /translation="MLEEIKSLPPLPISVVRIQEICMSNDTDIDELSRVIEHDPMLSAN
FT                   ILKSVNSPLYGMSKEISSVHQAVMLFGISMIRGFAAASAIKKSIIIDLSSYSVTIDDLT
FT                   KVSALQTALAREWYRNVDKSMLPLLQSSAFLMELGKLVASLKIISSGNLADFISDIAEG
FT                   KSVEETERKYLESSSYEIAAIMFEHWNFEPALIDALREITDPSTQNPYSRALRAITQAV
FT                   NFQEIFSEQSLSAALATIEEFGLNKDAFEEAVLTVKAAQKE"
     atgcttgaag agataaaaag ccttccgcct ttaccgattt cagttgttcg gattcaagaa        60
     atctgtatga gcaacgatac ggatattgat gagctctcac gtgtgatcga acatgatccg       120
     atgcttagtg ccaatatcct caaatcggtt aattcgccgt tgtatggaat gagtaaagag       180
     atttcttctg tccatcaggc ggtaatgtta tttggaattt cgatgattcg gggttttgcg       240
     gcagcaagcg ctatcaaaaa atcaattata atcgatctga gttcctattc ggtgaccatt       300
     gacgatttga caaaagtttc tgctcttcaa accgccttag cgcgtgaatg gtatcgaaat       360
     gttgacaaaa gtatgttgcc gttgctccaa agcagcgctt ttttaatgga actcggcaag       420
     cttgttgcat cgcttaaaat cattagttca ggaaatttgg ccgattttat aagtgatatt       480
     gccgaaggca aaagtgtaga agaaacggaa cgaaaatatc tcgagtccag cagttatgaa       540
     attgccgcaa tcatgtttga acattggaat tttgagccgg cccttatcga tgcgttaaga       600
     gaaataaccg atccttcgac tcaaaatcca tattcacggg ccttgagagc tattacccaa       660
     gccgtcaact ttcaagaaat ctttagcgag caaagcctaa gtgcggcatt agcgacaatc       720
     gaagaattcg gtttaaacaa agatgcgttt gaagaggctg tcctgacagt gaaagcggct       780
     caaaaagagt aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page