(data stored in ACNUC7421 zone)

EMBL: CP002355.PE84

CP002355.PE84        Location/Qualifiers
FT   CDS_pept        83545..83970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0084"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0027 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32752"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS1"
FT                   /protein_id="ADR32752.1"
FT                   /translation="MAGVMFSFYNFASLLDLNIGLSDRLDENRSESFTLLYCDFSNIPK
FT                   TLVESNLQSLLRTSDSIVHWEHYYFFVMPYTDRYGCGIVKKMIEEIFDRPIPSAAVCYP
FT                   VDGENPAELFEALHAEAKKLLNIDLDCLYSAENREVW"
     atggcaggag taatgttttc attttataat ttcgcatcgc tgcttgatct caatatcggt        60
     ctgtcggatc ggttggacga aaatcggtcg gagagtttta cacttttata ttgtgacttt       120
     tcaaatattc cgaaaacatt ggttgaatca aatcttcaga gccttttacg aacatccgat       180
     tcaattgttc attgggaaca ttattatttt tttgtaatgc cttatacgga ccgttacgga       240
     tgcggaatcg tcaaaaaaat gattgaagag atatttgatc gccccattcc ttcggctgca       300
     gtatgctatc cggttgacgg agagaatcct gcggaactgt ttgaggcact tcatgccgaa       360
     gcaaaaaagc ttctcaatat cgatttagac tgtctctaca gtgctgaaaa tcgtgaagtt       420
     tggtga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page