(data stored in ACNUC7421 zone)

EMBL: CP002355.PE85

CP002355.PE85        Location/Qualifiers
FT   CDS_pept        complement(83975..84598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0085"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cnb:CNBN0060 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32753"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS2"
FT                   /protein_id="ADR32753.1"
FT                   /translation="MKKLALIMMFSVTSVVLNAEEYTIQTISTLKESSITPAFEKKVEK
FT                   TSLHATKKKEGECNIVTVGSYKSVKEAHVDLKKAKVIAKDAFIRPIARTTPKVCETHTA
FT                   TAKVPSKEKKGEKAVSSVQAITATKEEAIAAVHEAVTPSTVATADAHTGTIMPSQTTKE
FT                   IQTPNNSPVFVYDRNLARKSDIQEAIEYYKRSPYYSFKPVLSLR"
     atgaaaaagt tagcccttat tatgatgttc agtgtcacca gcgtagtgtt gaatgcggag        60
     gaatatacga ttcaaacgat cagtactctt aaagagagtt cgatcactcc cgcttttgaa       120
     aaaaaagttg agaaaacttc cctccatgca acaaagaaaa aagagggtga atgtaatatt       180
     gtgacggtag gcagctataa aagcgtcaaa gaggcacatg ttgatcttaa aaaagccaaa       240
     gtaattgcca aagacgcatt tatccgccct atagcaagaa caaccccgaa agtgtgcgaa       300
     acacatactg ctaccgcaaa agtgccttca aaggagaaaa aaggagaaaa agcagtatct       360
     tctgtccaag ctattacagc tacaaaagaa gaagcaattg ctgccgtaca tgaagcggtt       420
     acaccatcaa ccgtagcgac agccgacgct catacgggta ctattatgcc gtcacagaca       480
     accaaagaaa tccaaacgcc taacaatagc cctgtttttg tttatgatcg taatcttgcc       540
     cgaaaaagcg atatccaaga agcgatagaa tactataaaa gatcacccta ttattctttt       600
     aaaccggttc taagcctccg ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page