(data stored in ACNUC7421 zone)

EMBL: CP002355.PE87

CP002355.PE87        Location/Qualifiers
FT   CDS_pept        85403..86092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0087"
FT                   /product="TonB family protein"
FT                   /note="InterPro IPR006260: IPR003538; KEGG:
FT                   cco:CCC13826_0392 ATP-binding protein; SPTR: Protein TonB;
FT                   TIGRFAM: TonB family protein; PFAM: Gram-negative bacterial
FT                   tonB protein; TIGRFAM: TonB family C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32755"
FT                   /db_xref="GOA:E4TWS4"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS4"
FT                   /protein_id="ADR32755.1"
FT                   /translation="MRSANSFFISVGIHLSLAALMIGTLSAVRKNTPAAEEKMVLNLLT
FT                   QTPAPKFPEPVAKPQPPVQPKVPLPAVKPPEARPVPQPKKTVTEQSKPFMNTPVQTAPL
FT                   APNVSSVPPARVTEQPIQPQAIKAVPPAQKQQERYEEENLGRIRSILMERLTYPKNALR
FT                   LKQEGEATVTFTFEPDREVSQISITKSSGFDLLDEAAKNLIISSASEFPKPSKTVRISV
FT                   PIAYKLR"
     gtgcgaagcg ccaactcttt ttttatttcg gtagggatcc atctttcgct ggccgcgctg        60
     atgatcggaa ctctcagcgc cgtacgcaaa aatacaccgg ctgcagagga gaagatggtt       120
     ctgaaccttc tgacgcaaac tcctgcgcca aaatttcccg aacctgtcgc aaaaccgcag       180
     ccgccagtgc agccgaaagt ccctttgcct gctgttaaac cgccggaggc ccgtccggtg       240
     cctcagccca aaaaaacagt taccgagcaa agcaaaccgt tcatgaatac accggtacaa       300
     acggctccgc ttgccccgaa tgtttcgagc gtccctccgg caagggttac cgaacaaccg       360
     attcagcccc aggcaataaa agcggttccg cctgcccaaa aacagcaaga acgttatgaa       420
     gaggaaaatt tgggaaggat tcgttctatt ttgatggaaa ggctcaccta tcctaaaaat       480
     gcattgcggt taaaacaaga aggagaggct accgtcacct ttacgttcga accagatcgc       540
     gaagtgagtc aaatctcaat caccaaaagt tccggatttg atctgcttga tgaagccgct       600
     aaaaatctga taatcagttc ggcctccgaa tttccaaaac cgtcaaaaac tgtccgaatc       660
     agcgtcccga tcgcgtataa gcttcggtaa                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page