(data stored in ACNUC7421 zone)

EMBL: CP002355.PE88

CP002355.PE88        Location/Qualifiers
FT   CDS_pept        complement(86096..86491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0041 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32756"
FT                   /db_xref="GOA:E4TWS5"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS5"
FT                   /protein_id="ADR32756.1"
FT                   /translation="MITANLVLTMIGLLFLLIGLVALYVWIGKSKTHAVLTPTTIETFE
FT                   SLSEIIKNRSSSSRELHHAVDMILKRFGSINAHTINQYQYLLEALCVHPHTDSKLILRF
FT                   EKTLRTNNPDYSNVIEKSLASGLAKRG"
     atgattacag caaatttagt attaacaatg ataggactgc tatttcttct catcgggttg        60
     gtcgcccttt atgtttggat cggcaaaagc aaaacacatg ccgtcttgac cccgacaacc       120
     attgaaacat tcgagtctct tagcgaaatt attaaaaaca gatcatcaag ttccagagag       180
     ttgcatcatg ccgttgatat gatcttgaag cgttttggaa gcattaatgc gcatacgata       240
     aatcaatatc aatatctgct tgaggcactc tgcgttcatc cccataccga ttccaaactc       300
     atactccgat ttgaaaaaac cctccggaca aacaatcccg actattccaa tgtgattgag       360
     aagtctcttg cttcagggct tgctaaaaga ggataa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page