(data stored in ACNUC7421 zone)

EMBL: CP002355.PE89

CP002355.PE89        Location/Qualifiers
FT   CDS_pept        86637..87887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0089"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG3174 membrane protein; KEGG: sun:SUN_2184
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein; PFAM: MgtC family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32757"
FT                   /db_xref="GOA:E4TWS6"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS6"
FT                   /protein_id="ADR32757.1"
FT                   /translation="MDSLFIQNSILSLVLGFLIGLQREMHTIYLHKAKDFGGARTFSMI
FT                   AFFGYLSAWFSAFIPYFFLIAAGLSGLLLIAAYIVNSLSASEKGTTTEFTALVTFVIGA
FT                   MLHFTLPLLAAFITMIVLFVLNLKEKIQEYEKTITKQDLSAAILFMLMTFVILPILPDR
FT                   AIDPMGLINLYRIWIMVVLVAGISFFGYIAIRILGSTHGISAAGLFGGLVSSTAVAMSM
FT                   ARRVHENGFLAKNLAMGIALASSVMLLRAGIEIWVINPALVQTFIIPIAIGTLAGYGYI
FT                   AMLYFTSKRENISQNIEFKNPFDLKEALVMGLVFGATLALISLSNRYIGDMGVYAVALV
FT                   SGIADVDAIILSLSSLAKNGLNPSTAHHAILIAIISNTFAKAALVLFFGKIGLFRLVIT
FT                   YYLISIGAFALTALLMY"
     atggattcgt tatttataca aaatagtatc ctctcattgg ttttgggatt tttgatcggg        60
     ttgcaacgtg aaatgcatac catctatttg cataaagcaa aagatttcgg aggggcccgt       120
     acattctcta tgattgcttt tttcggctat ctttccgcct ggttcagtgc ttttatccct       180
     tattttttct taatagcggc agggctttcg ggcttattgc ttatcgcagc gtatatcgtc       240
     aatagtttat ccgcatccga aaaagggaca acaaccgaat ttacggcact tgtcaccttt       300
     gtgatcgggg cgatgctgca ttttaccctt cctctgcttg ccgcgtttat cacgatgatc       360
     gtactgtttg tcctcaattt aaaagagaaa atccaggaat acgaaaagac tattaccaaa       420
     caggacctca gtgccgcgat tttatttatg ctcatgacgt ttgttattct tccgatcctt       480
     cctgaccggg caattgatcc gatgggattg atcaatttgt atcgaatatg gattatggtg       540
     gtattggttg cgggtatctc tttttttggc tatatcgcga ttagaatttt agggtctacc       600
     cacggcatca gtgctgccgg ccttttcggc ggattggttt cctctaccgc tgtcgccatg       660
     agtatggccc gtcgggttca tgaaaacggt ttcttggcta aaaatctggc tatggggatt       720
     gctctggctt catcggtgat gcttttacgt gcagggatcg agatatgggt catcaatccg       780
     gcgctggtac agacttttat catccctatc gctataggga cgttggcggg atatggctat       840
     atcgctatgc tctattttac gtcaaagcgt gaaaatatat ctcagaatat tgaatttaaa       900
     aatccgtttg atctcaaaga agccctcgtc atggggttgg ttttcggtgc tacgctggct       960
     cttatatcac tctcaaaccg ctatatcgga gacatgggcg tctatgcggt tgcgttggtt      1020
     tcggggattg ccgatgttga tgcgattatc ctctcgctct cttcgttggc aaagaacggg      1080
     ttaaacccct ctacggcaca ccatgcgatt cttatcgcca ttatcagcaa tacctttgct      1140
     aaagcggcat tggttctttt tttcgggaaa atcgggcttt ttcggctggt aattacctat      1200
     tatctgattt caatcggcgc atttgcattg acggcactgc tgatgtatta a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page