(data stored in ACNUC7421 zone)

EMBL: CP002355.PE9

CP002355.PE9         Location/Qualifiers
FT   CDS_pept        complement(9652..11040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0009"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="COGs: COG0617 tRNA nucleotidyltransferase/poly(A)
FT                   polymerase; InterPro IPR006675: IPR002646: IPR006674; KEGG:
FT                   ant:Arnit_0649 polynucleotide adenylyltransferase region;
FT                   PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase HD sub domain; SPTR:
FT                   Polynucleotide adenylyltransferase region; TIGRFAM: metal
FT                   dependent phophohydrolase; PFAM: HD domain; Poly A
FT                   polymerase head domain; TIGRFAM: uncharacterized domain
FT                   HDIG"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32677"
FT                   /db_xref="GOA:E4TW61"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW61"
FT                   /protein_id="ADR32677.1"
FT                   /translation="MIPLFPPLVRLVEHLSHHGIKPIFVGGFVRDFFTGHTTSDLDIEL
FT                   YGVTSLETLEALLRPFGKLGLYGKSFGVLKLNYEGYSIDFSPPRTESKSGFGHKGFELE
FT                   WFSDLDFSAAARRRDFTINAIGYDPLTQTLLDPFGGVEDLKAKRLRCVDPETFIDDPLR
FT                   VLRAVQFTARFELTCDKNLLALCRQMIANGALNELPKERIFEEFKKLLLQSNRPSIGMA
FT                   LLRDMGALGFFTPLDRLEETPQEKDSHPEGSVWVHTLMALDSMASLRCGEWRDDIILML
FT                   AVLLHDIGKPDTTLYADGILNAPKHAEIGAEMAQDWLERVTEDKTLISRILPLIRYHGW
FT                   PRKLYRSNALDSDILRLSTYVCIRDLILVAKADFFGRAFVGNIPEHFEAGEWLYERASA
FT                   LGVLVEPPVPLLMGRDLIALGMPPSEAFKSILNDAYDAQLNQLFFTRDQALEWLNIYLE
FT                   RGKL"
     atgatccctt tatttcctcc cttggtacga ctggttgaac atctttcaca tcacgggatc        60
     aaacctattt ttgtcggcgg atttgtccgc gacttcttca cggggcacac gacatccgat       120
     cttgatatcg agctttacgg agtaacttcc ctggaaacgc tcgaagccct ccttcgccct       180
     ttcggaaaat tggggctata cggaaaaagc ttcggcgttc taaaactcaa ttacgaaggg       240
     tactccatcg acttttcccc tccgcgtacc gaatccaaat caggattcgg acacaaggga       300
     tttgagctgg aatggtttag cgatctcgat ttttccgcag cggcacgccg acgtgatttt       360
     acgattaacg ccatcggtta cgacccgctt acccaaaccc ttctcgaccc gttcggtgga       420
     gttgaagatt taaaagccaa acggctcaga tgcgttgatc ccgaaacgtt tatagacgac       480
     cctctgcgag tactgcgggc cgtacagttt accgcccgtt ttgagctaac atgcgataaa       540
     aacttgttag cgctgtgccg ccaaatgatt gcaaacggag cgcttaatga acttccgaaa       600
     gaacgtattt ttgaagagtt taaaaagctt ctcctccaaa gtaaccgccc ctcaatcggg       660
     atggcattat tacgtgatat gggagccctt ggttttttta cccctcttga caggctagaa       720
     gaaactcccc aggaaaaaga ttcccatccc gaaggttccg tttgggtcca taccctgatg       780
     gcgctggatt cgatggcatc tctgcgttgc ggagagtgga gagatgatat catattgatg       840
     ttagccgtgt tattgcacga tatcggcaag cccgatacga ctctttacgc cgatggtatt       900
     ctcaatgccc cgaaacatgc cgaaatcgga gctgaaatgg cccaagactg gctggaacgg       960
     gtaaccgaag acaaaacact catcagccgt attttacccc ttatccgtta tcacggatgg      1020
     ccgcgaaaac tgtatcgctc aaatgccctc gacagcgaca ttctccgtct gagtacatac      1080
     gtctgtatcc gtgatctgat tttggttgca aaagccgatt ttttcggaag agccttcgtc      1140
     ggaaatatcc ctgaacattt tgaagcgggc gagtggctct atgagagagc ttcagcatta      1200
     ggtgttttag ttgaaccgcc cgttccacta ttgatgggac gcgatctgat cgcgttggga      1260
     atgcctcctt ccgaagcctt taaatcgatc ctgaatgatg cctacgacgc ccaacttaat      1320
     caactgtttt tcacccggga tcaagcactg gaatggctta atatctacct cgaaagaggc      1380
     aagctttaa                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page