(data stored in ACNUC7421 zone)

EMBL: CP002355.PE90

CP002355.PE90        Location/Qualifiers
FT   CDS_pept        87996..88925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_0927 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32758"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS7"
FT                   /protein_id="ADR32758.1"
FT                   /translation="MKVATHSLSLGAVSLHYRGEEEKLSLASSVQTFQKIEDGMGTAED
FT                   PLAEVDPKLRIMALLLEALTGQKISLTAFHSNSNVSDTANTASVSRENSPILEYQYHKE
FT                   ELNSMNFSAEGKVLLEDGSMKTFSLSIKWEQSFSESLRLRIQDGKILTDPLVISLDGTQ
FT                   PLSSNAFAFNLNGESEQSLPYLTGRAGYLAYDADQDGKITSGSELFGPKSGKGFMELSA
FT                   YDEDKNGWIDGNDSFFKQLRVWTITEGSESLLSLEEVGIGAISLQTTNVDFTLKRDIDD
FT                   PIAHYKKASVAVGENGEAYGIFEIDVAV"
     atgaaggtcg caactcattc tctttcccta ggtgcagtct ctctacatta tcgaggtgaa        60
     gaagaaaaat tgtcccttgc ttcatctgta cagacattcc aaaaaattga agatggtatg       120
     ggtacggcag aggatccgtt ggctgaggtc gatccgaaat tacggataat ggcacttttg       180
     ctcgaagcgt tgacaggaca gaaaatttcg cttaccgctt ttcactcaaa ttcaaatgta       240
     tccgatactg ccaacacggc gtcagtctca cgagaaaatt cgccgattct ggagtatcag       300
     tatcataagg aagagctcaa ttcgatgaat ttttcggcag agggaaaagt tcttttggaa       360
     gatggaagta tgaaaacgtt ctccctctct atcaaatggg agcaaagttt ctccgaatcg       420
     ctccgtttac ggattcaaga cggcaaaata ctcaccgatc cgttggttat ttctttggac       480
     ggtacacagc ctctttcatc caatgcattt gcctttaacc taaacggaga atcagaacag       540
     agcctcccgt atctaaccgg aagagccgga tatcttgcct atgatgcgga tcaagacgga       600
     aagatcactt caggctcgga gttgttcggt cctaaaagcg ggaaggggtt tatggagctt       660
     tccgcatacg atgaagataa aaacggatgg atagacggca acgattcttt ttttaaacaa       720
     ctgcgggtat ggacaataac cgaaggatcg gagagtcttc tttcccttga ggaagtcggc       780
     atcggagcaa tcagcctcca gacgacaaat gtggatttta ccctaaaacg ggacattgac       840
     gatcccatcg cacactataa aaaagcctct gtagccgtgg gagaaaacgg cgaagcatac       900
     ggtatatttg aaatcgatgt cgccgtataa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page