(data stored in ACNUC7421 zone)

EMBL: CP002355.PE91

CP002355.PE91        Location/Qualifiers
FT   CDS_pept        complement(88955..89575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0091"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="InterPro IPR000326; KEGG: cli:Clim_0637
FT                   phosphoesterase PA-phosphatase related; PFAM:
FT                   phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; SPTR:
FT                   Phosphoesterase PA-phosphatase related; PFAM: PAP2
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32759"
FT                   /db_xref="GOA:E4TWS8"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS8"
FT                   /protein_id="ADR32759.1"
FT                   /translation="MSENTSMIRTSLIVFLCAAFSFFYIDQVLALYFHNFHNSWVIAIF
FT                   NYITKLGDSLYSLALLSILFLLYRRQKPLFSQKMLYLFATVVLSGLIVDVIKIIVSRLR
FT                   PNMLFEHDMYGFVWFKLGYEFNSLPSGHSATAFALSIGLSLLFPRYKYLYILIGLLVVM
FT                   SRVILTCHYLSDILLGSLFGWLTALIIYRKYFTRSLIQCPAMS"
     gtgtctgaga atacatcaat gattcgaacc tcacttattg tatttttgtg tgcagctttt        60
     tctttctttt atatagacca agttttagct ctctattttc ataattttca taattcttgg       120
     gtcattgcta tttttaacta tatcaccaaa ctgggtgatt ctctatacag tttagccctt       180
     ttatctattc tttttctcct ttatcgtcga caaaaacccc ttttttctca aaaaatgttg       240
     tatctttttg ctaccgtagt tctaagcggc ttaatagtgg atgtaattaa aatcattgtt       300
     tcccgattgc gtccaaatat gttattcgag catgacatgt acggttttgt gtggtttaaa       360
     ctcggatatg aatttaactc tttgccctct gggcattctg caacggcatt tgctttatct       420
     atcggtctat cattgctgtt cccaaggtat aaatatctgt atattcttat tggactcttg       480
     gtagtcatga gcagagttat tctaacttgt cattacctga gtgatattct cttgggaagt       540
     ctcttcggtt ggcttacggc attaattatt tatcgaaaat attttacccg ttcactgatt       600
     caatgccctg ctatgtcata a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page