(data stored in ACNUC7421 zone)

EMBL: CP002355.PE92

CP002355.PE92        Location/Qualifiers
FT   CDS_pept        89927..91456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0092"
FT                   /product="diguanylate cyclase"
FT                   /note="COGs: COG2199 FOG: GGDEF domain; InterPro IPR000160;
FT                   KEGG: aeh:Mlg_2451 periplasmic sensor diguanylate
FT                   cyclase/phosphodiesterase; PFAM: GGDEF domain containing
FT                   protein; SMART: GGDEF domain containing protein; SPTR:
FT                   Diguanylate cyclase; TIGRFAM: diguanylate cyclase; PFAM:
FT                   GGDEF domain; Bacterial extracellular solute-binding
FT                   proteins, family 3; TIGRFAM: diguanylate cyclase (GGDEF)
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32760"
FT                   /db_xref="GOA:E4TWS9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWS9"
FT                   /protein_id="ADR32760.1"
FT                   /translation="MHLIFILLIATNLFSANSLTFGVFAYHSPSKIIKEYQPVVDHLSK
FT                   ELNTTITLKILSQQDLEKQVSQDKIDIIATNPTHFLALHAKGHVTGAMVTEVKKYDKFL
FT                   TPYLGGVIITRSDRHDIRTLQDLKGKVIAIPGKKFLGGFQTQNYEFEKLGINLNKYSVL
FT                   HKESNHNEVVKSVINGKADAGFVRTGIIEEMNIDKQLDKSKLFIINERHYHYFPLKIST
FT                   ELYPEWAIATSMHLPVPTVQKIVLALYSYKAKSNGRGVIEGFTIPADYANIDSLARVLR
FT                   LPPYEKAPHFTFVDVWDKYKFWIILLTISSTTIFILLIIVYRINRKLNQTSAELFDLAT
FT                   HDPLTGLFNRRGMMERLKFLLAELGRNKKNGALIYLDLDNFKPLNDSYGHAIGDELLIQ
FT                   VSKRIGMTVRAIDTIARMGGDEFLVILSHMEPTKVYEDAKQIAEKLRTVLNEPFSISIN
FT                   EELEIKHSISASIGMVIFDEHHKADTIIIHADAAMYEAKEQGRNRVVVGKC"
     atgcatttaa tatttattct tcttatagca actaatcttt ttagcgctaa ttcattaact        60
     tttggtgttt ttgcttatca tagtccttct aaaattatca aagagtatca acctgtcgta       120
     gaccatttgt ccaaagaact taacactact ataactttaa aaattctctc tcaacaagat       180
     ttagaaaaac aagtatcgca agataaaatc gatattattg cgaccaaccc tacccacttt       240
     ttagcactcc acgccaaagg acacgtgact ggtgcaatgg ttacagaagt taaaaagtat       300
     gataagtttc tgacgcctta tcttggaggg gttattatta ctagatcaga ccgtcacgat       360
     atccgaacac ttcaggattt aaaaggtaaa gtcatcgcca ttcctgggaa aaagttttta       420
     ggtggatttc aaacgcaaaa ttatgagttt gagaaattgg ggataaatct aaacaaatat       480
     tccgtacttc ataaggaatc taaccataat gaagttgtta aaagtgtaat aaatggtaaa       540
     gcggacgcag gatttgtgcg tacgggtatc attgaagaaa tgaacataga caaacaactg       600
     gataaatcca aactctttat tattaatgag cgtcattatc attattttcc attgaaaata       660
     tcgaccgagc tttatccaga atgggcaata gcaacatcta tgcatctgcc tgtacccacg       720
     gtacaaaaaa ttgtacttgc gttatatagc tataaagcaa aaagtaatgg aagaggggtt       780
     attgaagggt ttacaatacc agctgattat gcaaacattg attcacttgc acgtgtattg       840
     cgccttcctc cttatgaaaa agcgccacat tttacctttg tcgatgtttg ggataaatat       900
     aaattttgga ttatattatt gacaatcagc agtacgacta tttttatact tttaatcatc       960
     gtttatcgta ttaatagaaa attgaaccaa acatctgctg aattatttga tttggctact      1020
     catgatcctc ttacaggact tttcaatcgc agagggatga tggagcgatt aaaattttta      1080
     ttggcagagt taggaagaaa taaaaaaaac ggagcactta tttaccttga tcttgataac      1140
     ttcaaaccat taaatgattc ctacggacat gctataggtg atgaattgct tattcaagta      1200
     tcaaaacgaa ttggaatgac tgtccgtgct attgatacca ttgcccgtat ggggggagat      1260
     gagtttttag tcatactttc acatatggaa ccaacaaaag tttatgaaga tgctaaacaa      1320
     attgctgaaa aactccgcac ggtgcttaat gaaccattta gtatttcaat aaatgaagaa      1380
     ctagaaatca aacattctat ctctgcaagt atagggatgg ttatattcga tgagcatcat      1440
     aaagcggata cgataataat tcatgcagat gctgcaatgt atgaagcaaa ggaacaaggg      1500
     agaaatcgag ttgtagtggg gaagtgttag                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page