(data stored in ACNUC7421 zone)

EMBL: CP002355.PE93

CP002355.PE93        Location/Qualifiers
FT   CDS_pept        92050..93462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ant:Arnit_0995 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32761"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT0"
FT                   /protein_id="ADR32761.1"
FT                   /translation="MNTSINAPLGTEQEELNGVASIEVYNFPTASGIDSAYYFIESNAD
FT                   YKEFFHYSIFSVVESAKESNGGYVPKDSLTITISDIAFIYLGKDQGFYFFADRAGAFRV
FT                   GFKDPDTNQGVHDIRVQLQGIGIYALGLRFLADYINGTILKEISKPNYYITRADLNIFC
FT                   QYDLGNIIEPEHIVTRKRKFERIIGKKKGYETLYIGKPPARLRVYNKALEIDHTSMKTH
FT                   FLKSYLEPLGINVLEPFWNFEFECHRDFLKQYKINTLDDLLGNAEMLFHKMMEQIRLVD
FT                   TATITLKDIEANRLYKAPTHPLWNYLDQAYTFNAIDQKKIPLERIVYAPKELNANDFIE
FT                   EFRLLTQKYAEHSVIVNYEELRDVLHESRLWLTKKAQKVIKPFVPIELQTDQRKYLLTR
FT                   NHTAVAILPKSLEYISDTELITLESLLIKALHQELSYQDQDISLIVKHTQAVNEEKERR
FT                   RAGQKELELWQV"
     atgaatactt ctattaatgc tccattagga acggagcaag aagagttaaa cggtgttgcc        60
     tctatcgagg tttataattt cccgacggct tcgggaatcg attctgcata ttactttatt       120
     gagtccaatg ccgattataa agagttcttc cattattcga tcttctcggt cgttgaatcg       180
     gcaaaagagt ccaacggcgg atatgtcccc aaagattcat taacgattac gatctcggat       240
     attgcattca tctatcttgg taaagatcaa gggttttatt tctttgcaga tcgtgcggga       300
     gctttccgtg tcggcttcaa agaccccgat accaatcaag gggtgcatga tatccgtgta       360
     cagctccaag ggattggaat ctatgcactt ggattacgat tccttgctga ctatatcaac       420
     ggtacgatct taaaagagat cagcaagcct aactactaca taacccgcgc cgatctgaat       480
     atcttttgcc agtacgattt gggaaacatt atagagcctg aacacatcgt tacccgtaaa       540
     cgtaagtttg aacgcattat cggaaagaaa aagggatatg agactcttta tatcggtaaa       600
     cctcccgcac ggctccgtgt ctataacaaa gccttggaaa tcgatcacac ttccatgaaa       660
     acccattttt taaaaagtta tctcgaaccg ttaggcatca atgtactaga acctttttgg       720
     aactttgaat ttgaatgtca tagggatttc ctcaaacaat acaagatcaa taccctcgat       780
     gatctcttag gtaatgccga aatgctcttt cataaaatga tggaacaaat acgccttgtc       840
     gataccgcaa cgatcactct caaagacata gaagccaata gactctataa ggctcctaca       900
     catccattat ggaattatct cgatcaagcg tacacgttca acgccataga tcaaaaaaag       960
     attccgttag agcggattgt ctatgctccc aaagagttga acgctaatga ctttatcgaa      1020
     gagttccgat tgctcaccca aaaatatgct gaacactcgg tgatcgtcaa ttatgaagag      1080
     ttacgcgacg tactgcatga atcgagatta tggctcacca agaaagctca aaaagttatc      1140
     aagccgtttg tccctatcga actgcaaacc gatcagcgca aatacctgct cacccgtaac      1200
     catactgcgg ttgctatatt gcctaagtca ttagaatata tcagcgatac tgaactcata      1260
     acactcgaat ccttgcttat aaaagcactt catcaggagt tgagctatca agatcaagat      1320
     atctcattga tcgtcaaaca tacccaagcc gttaatgaag agaaagaacg cagaagagca      1380
     gggcaaaagg agttagagct atggcaagta tag                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page