(data stored in ACNUC7421 zone)

EMBL: CP002355.PE94

CP002355.PE94        Location/Qualifiers
FT   CDS_pept        93450..93887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_1996 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32762"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT1"
FT                   /protein_id="ADR32762.1"
FT                   /translation="MASIELITKEDFDELKALIIGAVRPLMTVEEAGEYLRLSPHTIRH
FT                   KIADQTFILGVHYSDKAGKILFAKERLDTWLWEESKESNNVSIQKKQSGVDRLIRQWSE
FT                   SQEIHGTGVDCKQRQKGRKRPHSPIKNGDNDGAGNTQKRAS"
     atggcaagta tagagctaat taccaaagaa gatttcgacg aactcaaagc cctcattatt        60
     ggagcggttc gcccactcat gacagttgaa gaggcagggg aatatttgcg attatcaccc       120
     cataccatcc gccataaaat cgccgatcaa acatttattc tcggagtaca ttattcagac       180
     aaagcaggta aaatactttt tgcaaaagag cgtctggata cttggctttg ggaggaatct       240
     aaggagtcaa acaatgtcag tattcaaaaa aaacaatcgg gtgtggatag acttattcgt       300
     caatggagcg agagtcagga aatccacggg actggagtgg actgcaagca acgtcaaaaa       360
     ggtcgaaaaa gacctcattc cccaattaaa aatggggata atgacggggc aggtaacact       420
     caaaaaagag cgtcttaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page