(data stored in ACNUC7421 zone)

EMBL: CP002355.PE95

CP002355.PE95        Location/Qualifiers
FT   CDS_pept        93892..94785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0095"
FT                   /product="integrase family protein"
FT                   /note="InterPro IPR002104; KEGG: sdl:Sdel_1112 integrase
FT                   family protein; PFAM: integrase family protein; SPTR:
FT                   Integrase family protein; manually curated; PFAM: Phage
FT                   integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32763"
FT                   /db_xref="GOA:E4TWT2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT2"
FT                   /protein_id="ADR32763.1"
FT                   /translation="MSYYADLFMDSKRQTTVPRTHERYLSIIKHSILPVFGDSPIRELK
FT                   VSNVEKWRNDLLKRFTAKTVKEYQIVLRGIFQKALHDEEIGKNPIDALDSLKVKKPHVV
FT                   PFMPYEVKLILDTAQGWFKNYLALGFMTGMRVGEIVALKWENVNLKKREIYVCASRIEG
FT                   VEGTTKTQSSIRYIPIIDTLVPFLEAQKKLSGDKEYVFVNQYGEVFYDYKTIGANQWKS
FT                   ILKECKLDHRRMYEMRHTCATNLLMSGQYSVNEIASILGHTTPQMLFERYTRNISAERK
FT                   PFNKTIDIYGVAGMAL"
     gtgagctatt acgctgattt attcatggac tcaaagcgac agacaactgt cccgcgaacc        60
     catgaacgct atttgtccat cataaaacat tcaatacttc cagtgttcgg agatagtccg       120
     attcgggagt taaaagtatc gaatgtcgag aaatggcgaa atgatctttt aaaacgtttt       180
     acagcaaaga cagtcaagga atatcaaatt gttctgcgag ggatttttca aaaagccctc       240
     catgatgaag agatcgggaa aaaccctata gatgcactgg atagtttaaa ggtgaaaaaa       300
     cctcatgttg tcccatttat gccttatgag gttaaactca tcttggacac ggcgcaggga       360
     tggtttaaaa actatcttgc gttaggattc atgacgggaa tgcgcgtcgg tgagattgtt       420
     gcccttaaat gggaaaacgt caatctgaaa aaacgggaaa tatacgtttg tgcttctcgg       480
     atagagggtg ttgagggaac aacgaaaaca caaagcagta ttcgttacat tccaatcatt       540
     gatactttag tacctttctt ggaagctcag aaaaaactga gtggcgataa agagtatgtg       600
     tttgtcaatc aatatggaga agtcttttat gattacaaaa ccattggtgc aaaccaatgg       660
     aaaagtattt taaaagagtg taaattagat catcggcgaa tgtatgaaat gcgccatacg       720
     tgcgcaacca atcttttaat gagtggtcag tacagtgtta atgaaattgc ttctatattg       780
     ggacatacga caccacaaat gctgtttgaa cgttatacga gaaacatatc ggctgagaga       840
     aaaccattta acaagacgat agatatatac ggtgtcgcag gtatggcact atag             894
//

If you have problems or comments...

PBIL Back to PBIL home page