(data stored in ACNUC7421 zone)

EMBL: CP002355.PE98

CP002355.PE98        Location/Qualifiers
FT   CDS_pept        complement(96807..97802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0098"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="COGs: COG0150 Phosphoribosylaminoimidazole (AIR)
FT                   synthetase; InterPro IPR004733: IPR000728: IPR010918; KEGG:
FT                   tdn:Suden_2050 phosphoribosylaminoimidazole synthetase;
FT                   PFAM: AIR synthase related protein domain protein; AIR
FT                   synthase related protein; PRIAM:
FT                   Phosphoribosylformylglycinamidine cyclo-ligase; SPTR:
FT                   Phosphoribosylformylglycinamidine cyclo-ligase; TIGRFAM:
FT                   phosphoribosylformylglycinamidine cyclo-ligase; PFAM: AIR
FT                   synthase related protein, N-terminal domain; AIR synthase
FT                   related protein, C-terminal domain; TIGRFAM:
FT                   phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32766"
FT                   /db_xref="GOA:E4TWT5"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT5"
FT                   /protein_id="ADR32766.1"
FT                   /translation="MSQISYKDAGVDIDAGNSFVENIKPLVKSTAIPGVLGGIGSFAGA
FT                   FELPSGYREPVMLAATDGVGTKLKLAIDSGIHNTVGIDLVAMCVNDLICNFGTPSFFLD
FT                   YYATGKLDVTAATAVVSGIAEGCRQAECALIGGETAEMPGMYHSDDYDLAGFAVGIGEK
FT                   SELDRSDKVQAGDILIALPSSGLHSNGFSLARKVLFEKMGMKFEDEFEGKPLIETLLTP
FT                   TRIYVKTFKALKNKIQALAHITGGGIVENFPRVLPEGLRAVITESSIRVLPIFELIGQH
FT                   VERAEMFRAFNMGVGMILVVKEADVADVLAATDGYVIGHLEEGKREAVLV"
     atgagccaaa tcagctataa agatgccggt gtcgatatcg atgcgggtaa cagttttgtc        60
     gaaaatatca aaccactcgt taaatcgacg gctatccccg gcgtattagg cggtatcggt       120
     tcgtttgcgg gagcgtttga actccctagc ggctaccgtg aacccgtaat gctcgctgcg       180
     acagacggtg tcggaacaaa actcaaactc gctatcgact cagggatcca caatacagtc       240
     ggaatcgatt tggtcgcaat gtgcgtcaac gatttgatct gtaatttcgg gaccccttca       300
     tttttcctcg attactatgc aaccgggaaa ctcgacgtca ctgccgcaac ggcagtcgta       360
     agcggtatcg cggaagggtg ccgccaggcg gaatgcgcac tcatcggcgg agagacggca       420
     gagatgccgg gaatgtacca tagcgatgat tacgatttgg cagggtttgc cgtcggtatc       480
     ggtgagaaaa gcgaactcga ccgctctgac aaagtgcaag cgggagatat tttgatcgca       540
     ttgccgagtt ccgggctcca ttcaaacgga ttctcattgg cgcgcaaagt tttgtttgag       600
     aaaatgggga tgaaattcga ggatgaattc gaaggaaaac ccttgatcga aacccttttg       660
     acccctacac gcatctatgt caaaaccttc aaagcgctca aaaacaaaat tcaagctctt       720
     gctcatatta caggcggggg aatcgtcgaa aatttccctc gcgtccttcc ggaaggactg       780
     cgtgcggtta ttaccgaatc atcgatccgt gtcttgccga ttttcgaact aatcggccaa       840
     cacgtcgaac gagctgaaat gttccgtgca ttcaatatgg gtgtcggaat gatcctcgtc       900
     gtgaaagaag ccgatgttgc cgatgtgctc gctgctactg acggctatgt aatcggtcat       960
     ctcgaagagg gcaaacggga agcggtttta gtctaa                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page