(data stored in ACNUC7421 zone)

EMBL: CP002355.PE99

CP002355.PE99        Location/Qualifiers
FT   CDS_pept        complement(97947..98150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0099"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdl:Sdel_1505 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32767"
FT                   /db_xref="GOA:E4TWT6"
FT                   /db_xref="UniProtKB/TrEMBL:E4TWT6"
FT                   /protein_id="ADR32767.1"
FT                   /translation="MCAEKIQRFLMAIVLTVALFLFASNQILYGMIIQTLVIVMVIIWA
FT                   IFDFCPSLWVFKKVFGKCPQKD"
     atgtgtgcag aaaaaattca acgttttttg atggctatcg tattaacggt cgcactgttt        60
     cttttcgcaa gcaaccaaat cctgtacgga atgatcattc aaacactcgt tattgtgatg       120
     gttatcattt gggctatctt tgatttctgc ccttcattat gggtattcaa aaaagttttt       180
     ggcaaatgcc cccaaaaaga ttaa                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page