(data stored in SCRATCH zone)

EMBL: CP002399.PE117

CP002399.PE117       Location/Qualifiers
FT   CDS_pept        116463..118319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0117"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: stp:Strop_0089 acyl-CoA dehydrogenase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05671"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ADU05671.1"
FT                   /translation="MTHYKSNVRDLEFNLFEVFGADRTFGQAPYTDLDVDTARSFLSEV
FT                   DRLAREDLAASYSDSDRNPPVFDPATFTAPLPESFKKSYKAFMDSEFWRLDLPETLGGT
FT                   NAPRALWWSLAELVLGANAPIWMYASGPSFAHVLHVEGTEEQKKWARLFIEKQWGSTMV
FT                   LTEPDAGSDVGAGRTRAIQQPDGSWHIEGVKRFITSGEHDLSDNIVHYVLARPVGVEGV
FT                   GGPGTKGLSLFVVPKYHFDAETGELGERNGVYATNVEHKMGLKVSNTCEVTFGEHGVPA
FT                   KGWLLGEKHDGIRQMFMIIEYARMMVGTKAIATLSTGYLNALEYAKNRVQGADLVQMTD
FT                   KTAPRVTITHHPDVRRSLLLQKSYAEGLRALVCYTASWQDKVAIAEAAGDEKATKLAKR
FT                   VNDLLLPLVKGVGSERAYELLGHESLQTYGGSGFLQDYPLEQYVRDAKIDTLYEGTTAI
FT                   QSLDLIFRKIVRDNGKALMAVAAEIQEHIASEAGNGQLKEERQALGKALAEIQNILGVM
FT                   TGWLGEAQGGDTRALYKVGLSSRRFLLAIGDLVVGWLLQKQADVALKALAGEVSAADKS
FT                   FYTGKVAAARFFAREVLPRIGADRRIIEGTDLEIMDLPEEAF"
     atgacccact acaagagcaa cgtgcgggac ctcgagttca acctgttcga ggtcttcggg        60
     gcggaccgga cgttcggcca ggcgccgtac acggacctgg acgtcgacac cgcccgtagc       120
     ttcctctccg aggtcgaccg cctcgcccgc gaggacctgg ccgccagcta ctcggacagc       180
     gaccgcaacc cgccggtctt cgacccggcg acgttcacgg cgccgctgcc ggagtcgttc       240
     aagaagtcgt acaaggcgtt catggactcc gagttctggc gcctggacct gccggagacc       300
     ctgggcggca ccaacgcccc gcgcgccctc tggtggtcgc tcgccgagct ggtgctcggc       360
     gccaacgccc cgatctggat gtacgcctcc ggcccgtcct tcgcgcacgt gctgcacgtc       420
     gagggcaccg aggagcagaa gaagtgggcc cggctgttca tcgagaagca gtggggctcg       480
     accatggtcc tcaccgagcc ggacgccggc tccgacgtgg gcgccggccg tacccgggcg       540
     atccagcagc cggacggctc gtggcacatc gagggcgtga agcgcttcat cacctccggt       600
     gagcacgacc tgagcgacaa catcgtccac tacgtgctgg cccgtccggt cggcgtcgag       660
     ggcgtcggcg gtccgggcac caagggcctg tcgctgttcg tcgtgccgaa gtaccacttc       720
     gacgccgaga ccggcgagct gggcgagcgc aacggcgtct acgcgacgaa cgtcgagcac       780
     aagatgggcc tgaaggtctc gaacacctgc gaggtgacct tcggcgagca cggcgtaccg       840
     gccaagggct ggctgctggg cgagaagcac gacggcatcc gccagatgtt catgatcatc       900
     gagtacgccc ggatgatggt cggcaccaag gcgatcgcca cgctctccac cggctacctc       960
     aacgccctgg agtacgccaa gaaccgggtg cagggtgccg acctcgtcca gatgaccgac      1020
     aagaccgccc cgcgggtgac catcacccac cacccggacg tgcgccgctc gctgctgctg      1080
     cagaagtcgt acgccgaggg cctgcgcgcg ctggtctgct acaccgcgag ctggcaggac      1140
     aaggtcgcga tcgccgaggc ggccggtgac gagaaggcca ccaagctggc gaagcgcgtc      1200
     aacgacctgc tcctgccgct ggtcaagggc gtcggttcgg agcgggcgta cgagctgctc      1260
     ggccacgagt cgctccagac ctacggcggt tccggcttcc tccaggacta cccgctggag      1320
     cagtacgtcc gggacgccaa gatcgacacc ctgtacgagg gcaccaccgc gatccagagc      1380
     ctcgacctga tcttccggaa gatcgtccgg gacaacggca aggccctgat ggcggtcgcc      1440
     gccgagatcc aggagcacat cgcctccgag gccggcaacg gccagctcaa ggaggagcgt      1500
     caggcgctcg gcaaggcgct cgccgagatc cagaacatcc tcggcgtgat gaccggctgg      1560
     ctgggcgagg cccagggcgg cgacacccgc gcgctctaca aggtcggcct gagcagccgc      1620
     cggttcctgc tggcgatcgg cgacctggtg gtcggctggc tgctccagaa gcaggcggac      1680
     gtggctctga aggcgctggc cggcgaggtc tccgcggccg acaagtcctt ctacaccggc      1740
     aaggtcgccg cggcccggtt cttcgcccgc gaggtgctgc cccgcatcgg cgccgaccgc      1800
     cggatcatcg agggcaccga cctggagatc atggacctcc cggaggaggc tttctga         1857
//

If you have problems or comments...

PBIL Back to PBIL home page