(data stored in SCRATCH zone)

EMBL: CP002399.PE118

CP002399.PE118       Location/Qualifiers
FT   CDS_pept        118504..118773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05672"
FT                   /inference="similar to AA sequence:KEGG:Sare_0087"
FT                   /protein_id="ADU05672.1"
FT                   /translation="MGIGSAIFLIALGAIMTFAIRANVWWIDLRAVGWVFILAGLGVLL
FT                   TTLWFWQDRRKRARTLIVEENRLSHPTAMMPPPPDPPPPTAPPS"
     atgggcattg gtagcgccat ctttctcatc gcgctcggcg cgatcatgac cttcgccatc        60
     cgggccaacg tctggtggat cgacctgcgc gcggtcggct gggtgttcat cctggccggg       120
     ctgggcgttc tgctgaccac gctgtggttc tggcaggacc gccgcaagcg ggcccgcacg       180
     ctcatcgtgg aggagaaccg gctctcgcat ccgacagcga tgatgccgcc gccgcccgac       240
     ccgccgccgc cgaccgcgcc gccgtcctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page