(data stored in SCRATCH zone)

EMBL: CP002399.PE119

CP002399.PE119       Location/Qualifiers
FT   CDS_pept        complement(118783..119649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ML5_0119"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: cai:Caci_5769
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ML5_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADU05673"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADU05673.1"
FT                   /translation="MARTTLPGGTWTLGDLTVTRFGYGAMQLAGPWVMGPPADHDGALA
FT                   VLREAVALGITHIDTSAAYGPYVTNRLIREALHPYPESLHVVTKVGADRDEQGGWPTAR
FT                   DPQSLRRQVRENLETLGVDALGLVNLRLGDATGPQPGSLAEALETLVALRQEGLIRHLG
FT                   LSNVTPEQVAEAQTIAPIVCVQNRYNLAHRGDDDLIDELARQGVAYVPFFPLGGFTPLQ
FT                   SSALSAVAERLGATPMGVALAWLLRRSPNILLIPGTKSVAHLRENVAGAGLALSGDDLA
FT                   ELDRIGR"
     atggcccgca ccacccttcc cggcggcacc tggacgctgg gcgacctgac cgtcacccgg        60
     ttcggctacg gcgcgatgca actcgccggc ccctgggtca tgggaccacc ggccgaccat       120
     gacggcgccc tggcggtgct gcgcgaggcg gtcgcactcg gcatcaccca catcgacacc       180
     agcgcggcgt acgggccgta cgtcaccaac cggctgatcc gggaggcgct gcacccgtac       240
     ccggagtcgc tgcacgtcgt cacgaaggtc ggcgcggacc gggacgagca gggcggctgg       300
     cccacggccc gggatccgca gagcctgcgc cggcaggtcc gggagaacct ggagacgcta       360
     ggcgtggacg cgctcggcct ggtcaacctg cggctcggcg acgccacggg gccgcagccc       420
     gggtcgctcg ccgaggcgct ggagacgctc gtcgcgctcc ggcaggaggg cctgatccgc       480
     cacctcggcc tgagcaacgt gacgcccgag caggtggccg aggcgcagac gatcgcgccg       540
     atcgtctgcg tgcagaaccg gtacaacctg gcccaccgcg gcgacgacga cctgatcgac       600
     gagttggccc ggcagggcgt cgcctacgtg ccgttcttcc cgctcggcgg gttcacgccg       660
     ttgcagtcct cggcgttgtc ggcggtggcg gaacgcctgg gggcgacgcc gatgggcgtc       720
     gccctggcct ggctgctgcg gcgctcgccg aacatcctgc tgatccccgg caccaagtcc       780
     gtcgcgcacc tgcgcgagaa cgtcgccggt gccgggctgg ccctctccgg cgacgacctc       840
     gccgaactgg accggatcgg ccgctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page